KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02672Help
Entry
EPYR_02672        CDS       T02121                                 

Gene name
asnB
Definition
asparagine synthase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:epr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2741019..2742683
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKSDPAELRKKALEMSRLMRHRGPDWSGVYADEHAILAHERLSIVDINNGA
QPLYNAAHTHVLAVNGEIYNHQALRAELSDRYAFQTHSDCEVILALYQEKGIEFLDDLQG
MFAFILYDSVKNTYLIGRDPIGIIPLYMGNDEHGNLFVASEMKALVPVCRSIKEFPAGSY
LSSTDGEIRRYWQRDWFDYSAVEQNTTDAHALKNALEESVKSHLMSDVPYGVLLSGGLDS
SIISAIAKRYAAKRVEDEDKSEAWWPQLHSFAVGLEGSPDLKAAKAVAEHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAREFHEENVRKLHALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KLCGSNGKMEKHILRECFASYLPESVAWRQKEQFSDGVGYSWIDTLKEMAAAQVSDQQLE
TAHFRFPFNTPTSKEAYLYRAIFAELFPLPSAAECVPGGPSVACSSAKAIEWDAAFKNMD
DPSGRAVGVHQSAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtactcgatctgaaaagcgatcctgctgaacttcgtaagaaa
gcccttgagatgtcgcgcctgatgcgccatcgcggcccggactggtccggtgtttatgct
gacgagcacgcgatccttgcccacgaacgactgtctatcgtcgacattaacaacggcgca
cagccgctttataacgcagcgcatacccacgttctcgcggtgaacggtgaaatttataac
catcaggctctgcgcgctgaattaagcgaccgctacgcgttccagacgcattctgactgt
gaagttattctggcgctgtaccaggaaaaaggcatcgaattccttgatgatctccaggga
atgttcgcctttatcctgtatgacagcgtgaaaaacacctacctgattggccgcgaccct
atcggcatcatcccgctttatatgggcaatgacgagcacggtaacctgtttgtggcttca
gaaatgaaggcgctggtgccggtttgccgcagcattaaagaattcccggccggcagctac
ctgtccagcaccgacggtgagatccgccgctactggcagcgtgactggtttgactactct
gctgtcgaacagaacaccacggacgctcacgcgctgaaaaatgcactggaagagtcagtc
aaaagccacctgatgtcagatgttccatatggcgttctactgtcaggcgggctggattct
tctattatctccgcgatcgctaaacgttatgcggcaaagcgggtagaagatgaagataaa
agcgaagcctggtggccacagctgcattcattcgccgtgggcctggaaggatcgccggac
ctgaaagccgcaaaagcggtggcagaacatctgggtacggtacatcacgaaattcatttc
accgtacaggagggactggatgccatccgtgatgtgatttaccacattgaaacctatgat
gtgaccaccattcgcgcctccacgccgatgtatttaatgtcacgcaaaatcaaggcgatg
ggtatcaagatggttttgtctggcgaaggtgctgacgaagtctttggtggctatctctat
ttccacaaggcgccgaacgcccgtgaattccatgaagagaacgtgcgcaagcttcacgcc
ctgcatatgtttgactgcgcgcgcgctaacaaagcgatgtctgcctggggtgttgaagca
cgcgtaccctttcttgataaaaaattcctggatgtggcaatgcgtatcaacccacaggac
aaactgtgtggcagcaatggcaaaatggaaaaacacatcctgcgtgagtgtttcgcctct
tacttgccagaaagcgtggcctggcgtcagaaagagcaattctctgacggcgttggttac
agctggatagataccctgaaagaaatggccgccgcacaggttagcgaccaacagctggag
acggcgcacttccgtttccctttcaacacgccaacatcgaaagaagcgtatctgtaccgc
gcaatcttcgcagaactgttcccgctccccagcgcagcagaatgcgtaccgggcggcccg
tcagtcgcctgttcttcggcgaaagccattgaatgggacgcagcgttcaaaaacatggac
gacccgtcaggacgtgctgtaggcgtgcaccagtccgcttattaa

DBGET integrated database retrieval system