KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02767Help
Entry
EPYR_02767        CDS       T02121                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EPYR_02767 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_02767 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EPYR_02767 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EPYR_02767 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EPYR_02767 (adhP)
   00626 Naphthalene degradation
    EPYR_02767 (adhP)
Enzymes [BR:epr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EPYR_02767 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2823849..2824655
Genome map
AA seq 268 aa AA seqDB search
MTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCREVINAGYTADGGMAEECIVVADYAVK
VPDGLDPAVASSITCAGVTTYKAVKISGISPGKWLVVYGLGGLGNLALQYAKNVFNAKVI
AVDVSDAQLKFAEEMGADMVINSRNEDAARLIQQRTGGAHAAVVTAVAKAAFNSAVDAMR
AGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEGKVVPKVTRRP
LQDINAIFHEMESGKIVGRMVIDFNSTH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccctcaagcccggcgaccgtgccagcgtggcgtggtttttcaaaggctgcggc
cattgtgaatactgcaacagcggcaatgaaaccctgtgccgagaggtgatcaacgccggt
tataccgccgatggcggcatggccgaagagtgtatcgtggtggcggattatgccgttaag
gtgcctgacggtctcgatcctgcggtcgccagcagcattacctgcgccggtgtcactacc
tacaaggcggtgaaaatctccggtatttctcccggaaaatggctggttgtctatggcctt
ggcggtctgggcaatctggcgctgcagtacgcaaaaaatgtgtttaatgccaaagtcatc
gccgttgacgtcagcgatgcccagctgaaatttgccgaagagatgggggccgatatggtg
atcaactcgcgtaatgaagacgcggcacggctgatccagcaacgcacggggggcgcacat
gctgccgtggtaacagccgttgccaaagcggcgtttaattctgcggtggatgcgatgcgc
gcaggtggccgtattgtggcagtgggcctgccgccggaatcgatgagcctgaatatcccg
cgtctggtgctggacggcatccaggtcgtcggctcgctggtcggcacgcgtgaagattta
gctgaagctttccagttcgcggctgaaggcaaagttgtacccaaagtcactcgccgcccg
ctgcaggacatcaacgcgatcttccatgaaatggaaagcggaaaaatcgttggccgcatg
gtgattgattttaacagtacccattaa

DBGET integrated database retrieval system