KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03167Help
Entry
EPYR_03167        CDS       T02121                                 

Gene name
dsbC
Definition
protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
Enzymes [BR:epr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EPYR_03167 (dsbC)
Secretion system [BR:epr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EPYR_03167 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3229468..3230172)
Genome map
AA seq 234 aa AA seqDB search
MKKHYLLLSVILAAASGLANADDAAIQQSLSKLGLQQTEIQPAPLPGFKTVLSESGVLYI
TDDGKHFIQGPLYDVSGGRPVNVTNKLLEKKVDALSKEMIVYKAAKEQHVVTVFTDITCG
YCHKLHQQMADYNALGITVRYLAFPREGMEGPVAKKMKSIWCAADRNKALDAAMKGEDVK
ATDCKIDLAQQFKLGAQYGIQGTPAMLLQDGTLVPGYQGAQELKKFLDGQKNGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcattacctgttactttcggtgatattagccgcagccagtggtctggcgaac
gctgatgatgcagcgattcagcagtcgttgagcaagctgggcttacagcagaccgagatc
cagcctgcgccgctgccgggttttaaaaccgtgctgagtgaaagcggtgtgctgtacatc
accgatgacggcaagcatttcatccaggggccgctttatgatgtcagcggcggccgcccg
gttaacgtcaccaataagctgctggaaaagaaagtggacgcgctgagtaaagagatgatc
gtttacaaagcggcgaaagagcagcatgtggtgacggtgtttaccgatatcacctgtggt
tactgccataagctgcatcagcagatggcggactataacgcgctggggatcaccgtacgc
tatctggccttcccgcgtgaagggatggaaggcccggtagcgaaaaaaatgaaatccatc
tggtgtgccgccgatcgtaacaaggcgcttgatgcggcaatgaaaggtgaagacgtgaag
gcgaccgactgcaagattgaccttgcacagcaattcaaactgggcgcccagtacggtatt
cagggtactccggccatgctgttgcaggacggcacgctggtccctggctaccagggagcg
caggaactgaagaaattccttgatggccagaaaaatggtgactga

DBGET integrated database retrieval system