KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03718Help
Entry
EPYR_03718        CDS       T02121                                 

Gene name
glgB
Definition
protein glgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EPYR_03718 (glgB)
Enzymes [BR:epr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EPYR_03718 (glgB)
Exosome [BR:epr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EPYR_03718 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3772052..3774268)
Genome map
AA seq 738 aa AA seqDB search
MPADRHGKNVMSELVDSRVINAVVSGHFADPFSVLGMHQTRLGLEVRALLPDASEVWVID
TRTGNQCVQLECLDARGFFQAVIPRRKKPFRYQLAVTWHGQQNLIDDAWRFGPLLPEMDS
WLLAEGTHLRPYETLGAHGTMIDGVAGTRFAVWAPNAQRVSVVGEFNYWDGRRHPMRLRR
EMGVWELFIPAARDGQLYKFEIIDNHGQLRLKADPYAFEAQMRPQSASMICGIPEKTRLS
PQRQRANGFDAPISIYEVHLGSWRRHTDNHFWLSYQELAQQLVPYAKEMGFTHLELMPVN
EHPFDGSWGYQPLGMYAPTRRFGTRDDFRAFITAAHQAGLNVLLDWVPGHFPADDFGLAK
FDGSELYEHGDPREGFHQDWNTLIYNFGRREVSNYLAGNALYWIERFGIDGLRVDAVASM
IYRDYSRANGEWVPNHFGGRENLEAIAFLRYTNRTLGHAAPGAITIAEESTDFNGVSRPP
ETGGLGFWFKWDLGWMHDTLDYMKLDPLYRRHHHNLMTFGMLYNNTENFVLPLSHDEVVH
GKGSILDRMPGDDWQKFANLRAYYGWMFGFPGKKLLFMGNEFAQGKEWNHDTSLDWHLLE
GKDGWHHGVQRLVRDLNHTYRAHPPLYQQDFDPAGFEWLVVDDVDNSVFVFVRRDCDGNE
LIVASNFTPVPRHGYRFGVSQAGRWREVLNTDSGHYHGSNMGNLGAVSTDDWGSHNRSHS
LSLTLPPLATLWLVREAQ
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgccgaccgtcacgggaagaatgtcatgtcagagctagtggatagtcgtgtgatt
aatgccgttgtctccggtcactttgctgaccccttttccgttttggggatgcaccaaacc
cgcctcggtctggaagtgcgcgccctgttgcctgatgccagcgaagtctgggtgatcgat
acccgtaccggtaatcaatgcgtgcagcttgagtgcctggacgcgcgtggtttttttcag
gcggtgatacccaggcgtaaaaagccgtttcgttatcagctggccgtcacctggcacggc
cagcaaaacctgatcgatgatgcctggcgctttggcccgctgctgccagagatggacagc
tggctgctggcggaggggacgcatctgcgtccctatgaaaccctgggcgctcatgggacg
atgattgatggtgtggccggtacgcgctttgcggtatgggcacctaatgctcagcgtgtt
tccgtggtcggtgagttcaactactgggatggacgccgccacccgatgcgcctgcggcgc
gaaatgggggtctgggagctgtttattcccgcagcgcgtgatggccagttatataaattc
gaaattatcgataatcacggccagctgcggctaaaggccgatccctatgcgtttgaagcg
cagatgcgcccgcaaagcgcttccatgatctgcggtattcctgaaaaaaccaggctgtca
ccgcagcgccaacgcgctaacggtttcgatgcacctatctccatctatgaagtgcatctc
ggctcctggcggcggcataccgacaatcatttctggctcagttatcaggagctggcgcag
cagctggtgccgtacgccaaagagatgggctttacccatctggaactgatgccggtcaat
gagcatccttttgacggcagttggggctatcagcctctgggcatgtacgcacctacccgc
cgttttggtacgcgcgatgatttccgcgcatttattactgcagctcatcaggccgggtta
aacgtcctgcttgactgggtgccgggccattttcctgcggatgatttcggactggcgaaa
tttgacggcagcgagctgtacgaacacggcgacccgcgtgagggattccaccaggactgg
aatacgctgatttacaattttggccgccgcgaggtcagtaactatctggcgggcaatgcg
ctgtactggatcgaacgctttggcattgatggcctgcgcgtggatgcggtggcttcgatg
atctaccgcgactacagccgtgccaacggggaatgggtcccgaatcatttcggcggtcgg
gaaaacctcgaagccatcgcctttctgcgttataccaaccgcacgctcggccatgccgcg
ccgggggcgattaccatcgccgaagagtcgacggactttaacggcgtatcgcgcccgccg
gaaacgggcgggctgggattctggtttaaatgggatctcggctggatgcacgacacgctg
gactatatgaagctcgacccgctctatcgccgccatcatcataatctgatgacctttggc
atgttgtacaacaacaccgaaaactttgtgctgccgctgtcgcacgatgaagtggttcat
ggcaagggttcaatcctcgaccgcatgccgggggatgactggcagaaatttgccaatctg
cgcgcctactacggctggatgttcggttttcccggtaaaaagctgctgtttatgggcaat
gaattcgcccagggcaaagagtggaaccatgacaccagcctggactggcatttactggaa
gggaaagacggctggcatcacggtgtacaacgcctggtgcgcgacctcaatcacacctac
cgtgcacatccaccgttgtatcagcaggattttgacccggcgggatttgaatggctggtg
gtggatgatgtcgataattcggtatttgtctttgtgcgccgcgattgcgacggtaatgaa
ctgattgttgccagtaacttcacgccggtaccgcgccacggctatcgctttggcgtgtca
caggcagggcgctggcgcgaagtgctgaataccgactccggccattatcacggcagcaac
atgggcaatctcggtgcggtcagtaccgatgactggggcagccataaccgcagccactcc
ctgagcctgacgctgccgccgctggcaacgctatggctggtgcgggaggcacaatga

DBGET integrated database retrieval system