KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03870Help
Entry
EPYR_03870        CDS       T02121                                 

Gene name
celA
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:epr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3915432..3916445)
Genome map
AA seq 337 aa AA seqDB search
MRNTRMAIVRAGFMLLVLILGLSQATAADGWSSFKTRFMTSDGRIQDTGNQNVSHTEGQG
YAMLMAVYYNDRSGFDKLWHWTQNNLSNPKNGLFYWKYNPAVRDPISDKNNAADGDVLIA
WALLKAGEKWQVSAWLQQSDLIQRAIVAHNVIAFGGRTVMLPGAQGFNKTSYVVLNPSYF
VFPAWRDFARRSHLKVWEQLIGDGQALLKEMRFGDSALPLDWVAMNADGSLAPATAWPPR
FSYDAIRIPLYLHWYDATSSGLVPFQRFWAGFQRLQTPAWVDVLSNDKAPYNMAGGLLAV
RDLTLGDTGYLNGSPGASEDYYSSSLHLLTWLAFKDR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaataccaggatggcaatagtcagggctggcttcatgctgttggtgcttatactg
ggcctgtctcaggcgactgccgcagatggctggagcagctttaaaacgcgctttatgacc
agcgatggtcgtattcaggatacgggcaatcagaacgtcagccacaccgaaggccaggga
tatgccatgctgatggcggtttactacaacgaccgcagcggctttgacaagctgtggcac
tggacacagaacaatctaagtaacccgaagaacggcctgttttactggaaatacaaccct
gcagtccgcgacccgattagcgataaaaataacgccgccgacggggatgtactgattgcc
tgggcgctgctgaaagcgggggaaaagtggcaggtttccgcctggttgcagcagtcagac
ctgatccagagggctattgtggcgcataacgtgattgcctttggcggtcgcaccgtgatg
cttcccggcgcgcagggctttaataaaaccagctacgtggtgctgaacccgtcctatttt
gtcttcccggcgtggcgtgattttgcccggcgcagtcatttaaaggtgtgggagcagctg
atcggcgacgggcaggcgttgctcaaggagatgcgttttggcgatagcgctttgccgctg
gactgggtggcaatgaacgctgacggctcgctggctccggctaccgcctggccaccgcga
tttagttatgatgccatccgtattccgttgtacctgcactggtacgacgccacgtcttcc
gggctggtgcctttccagcgtttctgggccggtttccagcgcctgcaaaccccggcatgg
gtagacgtgctaagcaacgataaagccccctacaatatggcaggcggcctgctggcggtg
cgtgatttaaccctgggtgataccgggtatctcaatggatcaccgggtgccagtgaagac
tattactcatcaagcctgcacctgttaacctggctggcgtttaaagaccgctaa

DBGET integrated database retrieval system