KEGG   Erwinia pyrifoliae Ep1/96: EpC_01090Help
Entry
EpC_01090         CDS       T01000                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EpC_01090 (pfkA)
   01230 Biosynthesis of amino acids
    EpC_01090 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_01090 (pfkA)
   00030 Pentose phosphate pathway
    EpC_01090 (pfkA)
   00051 Fructose and mannose metabolism
    EpC_01090 (pfkA)
   00052 Galactose metabolism
    EpC_01090 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EpC_01090 (pfkA)
Enzymes [BR:epy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EpC_01090 (pfkA)
Protein phosphatases and associated proteins [BR:epy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EpC_01090 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125446..126408
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAITEHICDIDELAKYIEQETK
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgccccaggcatgaatgcggcg
atccgtggtgttgtgcgcgccgcccttagcgaaggtcttgaagtttgcggcatttatgac
ggctatctgggcttgtatgaggaccgcatgatcaatctcgaccgctacagcgtatcggat
atgattaaccgtggcggtaccttcctgggttccgcacgcttcccggagtttcgccatgag
gatgtgcgcagcgtcgccatcgaaaacatgaagaaacgcggcatagacgcactggtggtg
atcggcggtgatggttcgtatatgggggccaagcgcctgaccgaaatgggcttcccatgt
attggtctgccgggcaccattgataacgacgtggccggcactgattacaccattggctat
ttcaccgcgctggaaaccgtggtggaggcgatcgaccgcttgcgtgatacttcgtcctcg
caccagcgtatttcaatcgttgaggtgatggggcgttactgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtactgccggaaattccttatactcgtgag
gagctggtgaatgagatcaaagccgggattgccaaaggtaaaaagcacgcgattgtagcg
atcacggaacatatctgcgatatcgacgagctggcgaaatatatcgaacaggaaaccaaa
cgcgaaacgcgctcaacggtgctgggtcatattcagcgcggcggtgctccggttgcttat
gaccgtattctcgcgtcacgcatgggtgcctactcgatagaactgctgttacaaggttac
ggtgggcgctgtgtcggcattcagaatgagaagatggtgcatcacgatattatcgatgcg
attgaaaacatgaaacgtccgtttaaaggtgactggctggataccgccaagaaactctac
tag

DBGET integrated database retrieval system