KEGG   Erwinia pyrifoliae Ep1/96: EpC_01090Help
Entry
EpC_01090         CDS       T01000                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:epy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:epy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:epy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:epy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:epy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:epy00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:epy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125446..126408
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAITEHICDIDELAKYIEQETK
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgccccaggcatgaatgcggcg
atccgtggtgttgtgcgcgccgcccttagcgaaggtcttgaagtttgcggcatttatgac
ggctatctgggcttgtatgaggaccgcatgatcaatctcgaccgctacagcgtatcggat
atgattaaccgtggcggtaccttcctgggttccgcacgcttcccggagtttcgccatgag
gatgtgcgcagcgtcgccatcgaaaacatgaagaaacgcggcatagacgcactggtggtg
atcggcggtgatggttcgtatatgggggccaagcgcctgaccgaaatgggcttcccatgt
attggtctgccgggcaccattgataacgacgtggccggcactgattacaccattggctat
ttcaccgcgctggaaaccgtggtggaggcgatcgaccgcttgcgtgatacttcgtcctcg
caccagcgtatttcaatcgttgaggtgatggggcgttactgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtactgccggaaattccttatactcgtgag
gagctggtgaatgagatcaaagccgggattgccaaaggtaaaaagcacgcgattgtagcg
atcacggaacatatctgcgatatcgacgagctggcgaaatatatcgaacaggaaaccaaa
cgcgaaacgcgctcaacggtgctgggtcatattcagcgcggcggtgctccggttgcttat
gaccgtattctcgcgtcacgcatgggtgcctactcgatagaactgctgttacaaggttac
ggtgggcgctgtgtcggcattcagaatgagaagatggtgcatcacgatattatcgatgcg
attgaaaacatgaaacgtccgtttaaaggtgactggctggataccgccaagaaactctac
tag

DBGET integrated database retrieval system