KEGG   Erwinia pyrifoliae Ep1/96: EpC_01260Help
Entry
EpC_01260         CDS       T01000                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EpC_01260 (tpiA)
   01230 Biosynthesis of amino acids
    EpC_01260 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_01260 (tpiA)
   00051 Fructose and mannose metabolism
    EpC_01260 (tpiA)
   00562 Inositol phosphate metabolism
    EpC_01260 (tpiA)
Enzymes [BR:epy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EpC_01260 (tpiA)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EpC_01260 (tpiA)
  Exosomal proteins of bladder cancer cells
   EpC_01260 (tpiA)
  Exosomal proteins of melanoma cells
   EpC_01260 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(144183..144950)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNKHMVNELIAGLRTELSGVDGCGVAIAPPVMYLDQAKQAISGSPVA
LGAQNVDVNLSGAFTGEVSAEMLKDIGARYIIIGHSERRTWHAESDELIAKKFAVLKATG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNSQGADAFTGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAQKDATVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaaactcaatggcaacaagcacatggtcaac
gaactgatcgccggtctgcgtaccgagctgagcggcgttgatggttgtggggtggcgatt
gctccccctgtcatgtatctggatcaggcgaagcaggccatttccggcagccctgtcgcc
ctgggtgcgcagaacgttgacgttaacctgtctggcgctttcactggcgaagtttctgcc
gagatgctgaaagacatcggcgcacggtacatcattattggccactccgagcgccgtacc
tggcacgcagaaagcgatgaactgattgcgaaaaaatttgccgtgctgaaggcgacgggt
ctgatcccggtgctgtgcattggtgaaaccgaagcggaaaatgaagcgggtaaaaccgaa
gaagtctgcgcacgtcagatcgatgcggtactgaattcgcagggcgctgatgctttcact
ggtgtggtgatcgcttatgaacccgtatgggcaatcggcacgggcaaatcagctaccccg
gctcaggctcaggcagtacacaaatttatccgcgaccatatcgcgcagaaagatgcgacg
gtggccgctcaggtcatcattcagtacggtggttctgtgaacgataaaaatgcggcagag
ctgtttgctcagccagatatcgacggcgctctggtgggcggcgcatccctgaaagccgat
gccttcgcagcgattgttaaagcggcggcggcggcgaaaagagcctga

DBGET integrated database retrieval system