KEGG   Erwinia pyrifoliae Ep1/96: EpC_01990Help
Entry
EpC_01990         CDS       T01000                                 

Gene name
hemD
Definition
Uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:epy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(230856..231605)
Genome map
AA seq 249 aa AA seqDB search
MSILVTRPSPAADELVSRLRQRGDVAWAFPLIEFAPGKQLDILPDRLKALKAGDLVFILS
QHVIHYARPTFTREDPPWPASLDYYAIGRSTGLAFHAASGHHVSWPHEQETSEVLIQLPA
LQAVAGKRALILRGNGGRELLAETLLSRGAQVEFIECYQRRAKHYHGAEEARRWRNQGID
TLVVTSGEMLQQLYSLFPDVDRDEWLLHCRLVVVSGRLATLARKLGWVNVDVAGGADNDA
LLRSLSLCP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggtcacccgcccgtcgccggcagcagatgagctggttagccgtctgcgt
cagcggggggatgttgcctgggcgttcccgctgatagagtttgcgccgggcaagcagctg
gatattctgcccgatcgtctgaaggcgctgaaggcaggagacctggtttttattctgtcg
cagcacgtcattcattatgcccggcccacgtttacccgcgaagatcccccctggcctgcc
agcctggactattatgctatagggcgcagtacggggctggcgtttcatgccgccagcggg
catcacgtttcctggccgcacgagcaggaaaccagtgaagtcctgatccagcttccggct
ttgcaggccgtggcgggcaagcgcgcattaattctgcgcggcaatggtggccgtgaatta
ctggcagaaactttgcttagccggggcgctcaggtagagtttattgaatgctatcaacgg
cgggcaaagcattatcacggtgcagaagaggcccggcgctggcgcaaccagggtattgat
acgctcgtggtgaccagcggtgaaatgttgcaacagctttactcactgttccccgatgtt
gatcgggatgaatggctactgcactgtcggctggtggtcgtcagtgggcgtctggccact
ctggcgcgaaaacttgggtgggtgaacgtggatgtcgccggcggtgccgataacgatgcg
ctattgcgctcgctatcattatgcccttaa

DBGET integrated database retrieval system