KEGG   Erwinia pyrifoliae Ep1/96: EpC_03750Help
Entry
EpC_03750         CDS       T01000                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EpC_03750
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EpC_03750
Enzymes [BR:epy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EpC_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447094..449466
Genome map
AA seq 790 aa AA seqDB search
MLWSPCRILLAFSVILPLCAAAVPAGDLPLMPWPQKVELAADAASLTLIIPLDIQVKGDD
LQEAVPRWQRRLARQTGKAYYPLPASATPLQIHIANRVAPVPQPDSDESYRLVVSRDGVH
LDSATRFGAMRGMETLLQLVQNGALPLVTIDDRPRFPWRGMMIDSVRHFMPLETLKRQID
GIAAARMNVFHWHLTDDQGWRFASSRFPQLQAKASDGLWYSEQQMREIVSYATDRGVRVV
PEIDLPGHVPALAVAMPQLLAIPGRYQPERGWGVFKPLLDPTNEQVYRFIDLLVGEVAAI
FPDPYLHIGGDEVDDTQWRKSERISQFMQRQGLKDGHALQAYFNQRVEKILAKHQRRTIG
WDEIYHPDLPRSILIQSSRGANALGEIAKNNYRGILSAGFYLDQAQPAAFHYRNEVWPQA
LNGADRVRAGETAQSWQFSLPRLKGDPLNGSFTLIDSAGGWRGFIDFAGRSRRMVQNMRW
LSPTQLTFSVDSWMGNLQPVLTLAGDSLNGYWRIGNVRYSTTGSMLAQIPQGIKPALPDE
AQLRENLLGGEAVLWSEIVDENIIDIRLWPRAFAVAERLWSAADVTDEKNMYQRLAAVDN
WSALSVGLQQHTQMQLQMMRLANGNDIAPLHIFAEALEPAQYYTRQHLKHRAGHSTLAEP
LNQLADILPTESSKVRELDRQVDALIANRGDRQAALAIRRQLELWQFNILQVEPLLASNP
QLRPLLTVAEQVGAISKVGLSLVDAMENERIFGAREVAKMQQLLDSEALRQDELVIALLY
PIEKLLWADK
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgctatggtcaccgtgccgcatactgcttgcttttagtgttatcttgccgctctgcgcg
gctgccgtgccggccggggatctgccgctgatgccgtggccacagaaggtggaactggcc
gccgatgcagccagcctgacgctgatcatcccgctggatattcaggtaaaaggcgacgat
ctgcaggaagccgtgccgcgctggcagcggcgtctggcgcgtcagacgggtaaagcgtat
tacccccttccagccagcgccacgccgctgcaaatccatatcgcaaaccgggtcgcccct
gttccccagcctgacagcgatgaaagctatcgtctggtggtcagccgtgacggcgtgcat
ctggacagtgccacgcgctttggcgccatgcgcggtatggaaacgctgttgcagctggtt
caaaatggggcgctgccgctggtgaccatcgatgaccgcccacgttttccgtggcgcggc
atgatgattgattctgtccggcactttatgccgctggagaccctgaagcggcagattgat
ggcatcgccgccgcacgcatgaacgtgtttcactggcatctgaccgatgaccagggctgg
cgctttgcctccagccgctttccgcagctgcaggcaaaagccagcgatggcctgtggtac
agcgagcagcagatgcgcgagattgtcagctatgccaccgatcgcggcgtgcgggtggtg
ccggagatagacttacccggccatgtacccgcgctggcggtcgccatgccgcagctgctg
gccattccggggcgctatcaaccggagcgcggctggggcgtgttcaaacccttacttgat
ccgactaacgaacaggtttatcggtttattgacctgctggtcggcgaggtggcggcgatc
ttccccgacccgtatttacacattggtggcgatgaggtggacgatacgcaatggcggaaa
tccgagcgcatcagccagtttatgcagcggcaaggactgaaggatggccacgccctacag
gcttactttaatcagcgggtggagaagatcctggcaaaacaccagcgccgcaccatcggc
tgggacgaaatttatcatcccgacctgccgcgcagcattctgatccagtcatcgcgggga
gccaatgcgctgggagaaatagcgaaaaacaactatcgcggcatcctgtctgctggtttc
tatctcgatcaggcacagccagccgcttttcattaccgcaatgaagtatggccgcaggcg
ttgaacggcgccgaccgggtgagagcaggtgaaacggcgcaaagctggcagtttagtttg
ccccggctgaagggcgacccgctaaacggcagttttaccctgattgacagcgcgggcgga
tggcgaggttttattgattttgccggacggtcgcggcgcatggtgcaaaacatgcgctgg
ctttcgccgacccagctaaccttcagcgttgacagctggatgggaaatctacagccggta
ctgacgttggcgggcgacagcctgaacggctactggcgtattggcaacgtgcgatattcg
accacgggcagcatgctggcgcagataccgcaaggcataaaacctgccttacccgatgag
gcgcagctcagggagaatctgctgggaggggaagcggtgctgtggagtgaaatcgttgat
gaaaacatcattgatatccgtttgtggccacgggcgtttgccgttgccgagcgactgtgg
tcggcagcggatgtcactgacgaaaaaaatatgtatcagcggctggcggcggtcgacaac
tggtcggcgctatctgtgggcctgcaacagcacacacaaatgcagctacaaatgatgcgc
cttgccaacggcaacgatatcgcaccgctacacatttttgccgaggcgctggaaccggcg
cagtactacacgcgtcagcatctcaagcaccgcgccgggcattcaacgctggcagagcct
cttaaccagctggcggatattttacccaccgagagcagcaaggtacgggaacttgaccgt
caggtggatgcgctgattgccaaccgtggagaccgccaggcggcgctggcgatacgtcgc
cagctggagctatggcagttcaatattctacaggttgaacccttgctggcgagcaatccg
cagctgcgaccgctgttaacggtagcagaacaggtaggggctatcagcaaggtggggctg
tcactggtggatgcgatggaaaatgagcgcattttcggcgcgcgtgaagtcgcgaagatg
cagcagttactcgatagtgaggcgctcaggcaggatgagttggtgatcgcgctactttac
ccgattgagaaattgctgtgggcggacaaataa

DBGET integrated database retrieval system