KEGG   Erwinia pyrifoliae Ep1/96: EpC_03780Help
Entry
EpC_03780         CDS       T01000                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:epy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:epy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(450560..451495)
Genome map
AA seq 311 aa AA seqDB search
MANPLYRKHIISINDLNRTELERVLHTAASLKANPQPELLKHNVIASCFFEASTRTRLSF
ETAMHRLGASVVGFADGGNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNLQVAMVGDLKYGRTVHSLAQALAKF
DDNRFWFIAPDALAMPTYITDMLDEKGITWSRHDSIEEVVPQVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLNGARDNMKVLHPLPRVDEIDNDVDSTPHAWYFQQAGNGIYARQAL
LALVLNSDPAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcgcaagcatattatttccattaacgatctcaaccgtaccgag
ctggaacgggtgctgcacaccgctgccagcctgaaagcgaacccgcagccggaattgttg
aaacataatgtgattgccagctgcttctttgaagcctcaacccggactcgcctgtcgttt
gaaaccgccatgcaccgccttggggcttcggtggtgggctttgccgacggcggcaatacc
tctctgggtaagaaaggtgaaacccttgccgatactatttcggtgattagcacctatgtg
gatgccatcgtgatgcgccatccgcaagaaggggccgcccgactggcgaccgaattttcc
ggcggcgtgccggtgctgaatgcgggagacggagccaaccagcatccgacccagacgctg
ctcgacctgttcaccatccaggaaacccaggggcgtttgaacaatttgcaggtagcgatg
gttggcgacctgaaatatggccgtaccgtgcactcgctggcgcaggcgctggcgaaattt
gacgacaaccgcttctggtttatcgccccggacgcgttggcaatgccgacttatatcacc
gatatgctggacgaaaaaggcattacctggtcgcgccacgacagcattgaggaggtggta
ccacaggtggatattctgtatatgacccgcgtgcagaaagagcggctggacccatcggaa
tatgccaatgtaaaagcgcagtttgtgctgcgcgctgccgatttgaacggtgcgcgtgac
aatatgaaggtactgcatccgctaccgcgtgttgatgaaatcgacaacgacgtcgacagc
acgccgcacgcctggtatttccagcaggcaggcaacggcatttacgcacgccaggcgctg
ctggcgctggtactcaacagtgacccggctctgtaa

DBGET integrated database retrieval system