KEGG   Erwinia pyrifoliae Ep1/96: EpC_03980Help
Entry
EpC_03980         CDS       T01000                                 

Gene name
asn
Definition
Asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EpC_03980 (asn)
Enzymes [BR:epy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     EpC_03980 (asn)
Peptidases [BR:epy01002]
 Cysteine Peptidases
  Family C44
   EpC_03980 (asn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(474977..476815)
Genome map
AA seq 612 aa AA seqDB search
MCGIAGWATFSRDFHASRRELEAMAATMALRGPDASGFWMDRHAGLSHRRLAIVDLEGGV
QPMTANLPTGSISLSYSGEVYNFKELRQELTQAGHSFSTQSDTEVVLKGYLQWGNGVCEK
LNGMFGFAIWDARREVLLLARDRFGVKPLYYYPDGQSVLFGSEPKAILAHSQISGVLTTD
SLREALGWTKTPGHGTWEGLKEVKPGTFVQFGRDGVREDVYWQLQSRPHHDSLKDTIENV
HILLSDTVRRQMVSDVPLCSLLSGGLDSSAIAALASQQLNGERQLKTFAVDFETHTEQFV
PDVFRNESDAPYARKVAEKIGSLHTNLVLGYQQIGSEETRRAVIAARDLPTGFGDADNSI
YLLFNAIRNEATVALSGESADEVFGGYRWFHQPGILQGNTFPWADHTFVTSFKTGLDAFA
PDLLASLELPDYVRSRYQEALAEVPRLAGEESHEAKMREVLYLHLTRYMRILLDRKDRLS
MAAGLEVRVPFCDHRLVEYVFNTPWKMKTFDGREKSLLRAAMGDLLPQEVLQRKKAPYPA
IQNAHYSAVLQRQAADLVANTNHPARDLLNIRWLNSILHIDPAAMSREIRHGLERALDFA
TWIELRKPILKL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgcaggatgggcaacgtttagccgtgattttcacgccagtcggcgcgaa
ctggaagcgatggcagcaacgatggcgttacgggggccggatgcctcaggtttttggatg
gatcgacatgcaggtttgagccaccgccgtttagccatagttgatctcgaaggcggtgtt
cagccaatgacggcaaatttaccgacgggcagcatttcgctttcttacagcggtgaagtg
tataactttaaagaattacgccaggaactgacgcaagcagggcactcgttttcaacccaa
agcgacacggaagtggtgttgaaagggtatttacaatggggaaatggcgtctgcgagaag
ttaaatggcatgtttggcttcgccatctgggatgcgcggcgtgaggtgctgttgctggcg
cgcgacagatttggcgtaaaaccgctttattactatcctgacgggcagtcggtgctgttt
ggctccgagcctaaagccattctcgcccattcacaaatatctggcgttctgaccaccgac
agcttgcgtgaagcgctggggtggaccaaaaccccaggacatgggacatgggaagggctt
aaagaagtcaaacccggaacctttgtgcagtttggccgggatggggtgcgagaagatgtt
tattggcagctccagtccaggccgcaccatgactcgttaaaagacactatcgaaaatgtg
catatcctgctttctgacacggtaagaaggcaaatggtttccgatgtaccgctctgcagc
ctgctttctggcggtctggactccagcgccattgcggctctcgccagccagcagctaaat
ggagagcgccaacttaaaacctttgctgtcgattttgagacccatacggagcaatttgta
ccggacgtattccgcaacgaatccgatgcgccctatgcccgtaaagtcgcggaaaaaatt
ggctccttgcacaccaatctggtgctgggttaccagcagattggcagcgaagaaacccgg
cgggcagttattgctgcgcgggacttgcccaccggttttggcgatgcggacaattcaatt
tacctgctttttaacgccatcaggaacgaggcaacagtcgccctttccggtgagtcggca
gatgaggttttcggcggctatcgctggtttcatcagccgggcatattgcaggggaacacc
ttcccctgggcagatcacacctttgtaaccagtttcaaaaccggactggatgccttcgca
ccagatttgttggcgagcctggaattgccggattacgtgcgttctcgctatcaggaagcc
ttagcagaagtcccgcgcctggccggcgaagagagtcatgaagccaaaatgcgcgaagtg
ctctacctgcacctgacacgctatatgcgcatcttactggacagaaaagatcgcctgagt
atggcggcaggtctggaagttcgtgtgccgttttgcgatcaccggcttgttgaatatgtt
tttaataccccgtggaaaatgaaaacctttgacggccgggaaaaaagcctgctgcgtgcg
gcgatgggtgatttactgccgcaagaggtactgcaacgcaagaaagcgccgtatcccgcc
attcaaaatgcacactacagtgctgtattgcagcgccaggcggccgaccttgtggcgaac
actaaccaccctgcccgggatttgctcaatattcgctggcttaacagtatattacacatc
gatcctgcggcgatgagccgggaaattcgtcatgggttagagcgtgcgctggatttcgct
acctggatcgaacttcgtaagccaatactgaagctttaa

DBGET integrated database retrieval system