KEGG   Erwinia pyrifoliae Ep1/96: EpC_05960Help
Entry
EpC_05960         CDS       T01000                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
epy  Erwinia pyrifoliae Ep1/96
Brite
Enzymes [BR:epy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EpC_05960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692836..693345
Genome map
AA seq 169 aa AA seqDB search
MNHSIVKHCAVGAVLAAAAMLPKYQQLHTSPDGLKLLADYEGCHLMPYQCSAGIWTDGIG
NTEGVVSGRSITGQQAAGNLITNVLRVESALAQCLTEPVPQSVYDSLVSLAFNVGTTKTC
GSTMVKLLNEKRWRDACQQLPRWIYVKGVFNPGLKKRRAREMAWCLTGI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcaatcgttaaacattgtgctgtcggcgcggtactggctgctgctgccatg
ctgccgaaatatcagcagctgcatacctcaccagatgggctgaaactgttggcggactat
gaaggctgtcatctgatgccttatcagtgcagcgccgggatatggacggacggcatcggc
aacaccgaaggcgtggtatcgggccgcagcattaccgggcagcaggcagcagggaattta
atcaccaatgtactgcgcgttgaatcagcactggcgcagtgtttgacggaacctgtgccg
cagtcagtgtatgactcgctggtctctctggcctttaacgtcggtaccactaaaacctgt
ggttcgacgatggtgaagctgctaaacgaaaagcgctggcgtgacgcctgccagcagctg
ccgcgctggatctatgttaaaggcgtgttcaacccggggcttaaaaagcgccgcgcaagg
gagatggcgtggtgcctgaccggaatatga

DBGET integrated database retrieval system