KEGG   Erwinia pyrifoliae Ep1/96: EpC_06620Help
Entry
EpC_06620         CDS       T01000                                 

Gene name
deoA
Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EpC_06620 (deoA)
Enzymes [BR:epy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EpC_06620 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
768140..769462
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGHALSEEEIRLFINGVCDNSVSEGQIAALAMAIWFRDMTLPERVALT
MAMRDSGSVLSWKALDLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPQDDRFRQIIKQVGVAIVGQTRSLAPADKRFYATRDITATVDSI
PLIAASILAKKLAEGLDALVMDVKVGSGALMPALEQSEALAQAIFGVANGAGCHTTVLLT
DMNQALASRAGNALEVREAVQFLTGEYRNPRLLEVTMALCSEMLLSGGLAQSGDEAQIKL
QAVLDNGAAAEVFARMVAAQKGPTDFIERIDSYLPVPMLSKAVYANTSGIVSAMDTRALG
MAVVALGGGRRRASDSIDYSVGFSDLVQLGDKVGSQRPLAVIHAASEAGWQQAARALQHA
VVVGQVAPASTPVIYRRISQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctgccacaagaaattatccgcaaaaaacgtgatggtcatgcactaagcgaagaa
gagatccgtctgtttattaacggcgtgtgtgacaactcggtttccgaggggcagatcgcc
gcgctggcgatggccatctggtttcgtgatatgacgctgccggagcgtgtggcgctgacg
atggcgatgcgcgattccggttcggtactcagctggaaagcgctggatctcaacggcccg
gtggtggacaaacactcaaccggcggcgtgggcgatgtcacgtcgctgatgcttggccca
atggtggctgcctgtggcggctatgtgccgatgatctccggccgtgggctgggtcatacc
ggcggcacgctggataaactggaagccattcccggttttgatattttcccgcaggacgac
cggttccgccagattatcaaacaggtaggggtggcgatcgtcggccagacccggtcgctg
gctccggcggataagcgcttctatgccacgcgtgatattaccgccacggtagattcaatc
ccgcttattgctgcctcgatcctcgccaagaaactggctgaaggtcttgatgccttggtc
atggacgtgaaagtgggttccggggcgctgatgcctgctcttgaacaatccgaagcgctg
gcgcaggccatttttggcgtagcaaacggtgccggttgtcacaccaccgtgctgttaacc
gatatgaaccaggcgctggcttcccgcgccggtaatgcgctggaagtgcgtgaagcggtg
cagttcctgaccggcgaataccgcaatccgcgcctgctggaagtgacgatggcgctgtgc
agcgaaatgttgctctccggcgggctggcgcagtcaggcgatgaagcgcagattaagctg
caggcggtgctggacaacggtgccgccgccgaggtgtttgcgcgcatggtagcggcgcag
aaggggccgactgactttatcgagcgtatcgacagttatctgcctgtcccgatgctgagc
aaagcggtttatgccaacaccagcggcatcgtcagcgcgatggacacccgtgcgctgggg
atggcggtagtggcgctgggcggcggtcgccgccgggccagcgacagcattgactacagc
gttggcttcagcgacctggtgcagctgggcgataaggtgggtagccagcgtccgctggcg
gtgatccatgctgccagcgaagccggctggcagcaggccgctcgggccttgcagcacgcc
gtcgttgtcgggcaggtggcgccggcatcaacgccagttatttatcgcagaatctcgcaa
taa

DBGET integrated database retrieval system