KEGG   Erwinia pyrifoliae Ep1/96: EpC_06880Help
Entry
EpC_06880         CDS       T01000                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00260  Glycine, serine and threonine metabolism
epy00750  Vitamin B6 metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01230  Biosynthesis of amino acids
Module
epy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EpC_06880 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EpC_06880 (thrC)
Enzymes [BR:epy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EpC_06880 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAX54467
Position
799110..800396
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTEIDDMLEMDFVTRSSKILS
AFIGDEIPPHQLNERLKTAFTFPAPVVEVTDNIAALELFHGPTLAFKDFGGRFMAQMLSY
VSDADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEALKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLANGEWTPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLTDLGYGAVDDETTKAAMRELADLGYLSEPHAAIAWR
LLHEGLQEGEFGLFLCTAHPAKFKESVEEILQRTLPLPDALAERAELPLLSHRMKAEFAD
LRAFLLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtgagcttcgcccaggcggtgaag
caggggctgggcaaacagcagggcctgttctttcctctggagttacctgagtttgaactg
actgaaattgatgacatgctggaaatggatttcgtgacccgtagcagtaaaattctttcg
gcgtttatcggtgatgaaattcctccgcatcagctgaatgagcgtttgaaaacggcgttt
accttcccggcaccggtggtggaagtcactgataatatcgccgcgctggagctgttccac
ggcccgacgctggcgtttaaagactttggcggccgctttatggcgcagatgctctcttat
gtcagcgatgcggacgagcagatcactattctgactgcgacttcaggcgataccggagcc
gccgttgctcatgctttctacggcatggaaaacgtgcgcgtggtgatcctttatccacag
ggcaagatcagcccgctacaggaaaaactgttctgtaccctcggtggcaatatcgagacc
atcgccattgacggcgatttcgatgtttgccagtcgctggttaaacaggcgtttgacgat
gaagcgctgaaaaaggccattggcctgaattcggcgaactcgattaatatcagccgcctg
ctggcgcagatctgctactactttgaagccgtggcgcagctgccgcaggaaaaacgtaat
cagctggtgatttcggtgccgagcggtaactttggcgacctgacggctggcctgctggcg
aagtctctcggcctgccggtgaagcgttttatcgctgccaccaacgccaatgacaccgta
ccgcgcttcctggccaacggcgagtggacgcccaacgccaccgtggccacgctgtcaaac
gcgatggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccggcgtaaa
acctggcgcttaacggatctcggctatggtgcggtcgacgatgagaccaccaaagcggcc
atgcgtgagctggccgatctcggttacctttccgagccacatgcggctatcgcctggcgc
ctgctgcatgagggattacaggaaggggagtttggtctgttcctctgcaccgcgcacccg
gcgaaatttaaagagagcgtggaagagatcctgcaacgcaccctgccgctgccggatgca
ctggccgagcgtgccgagctgccgttgctgtctcaccgcatgaaagcggaatttgccgac
ctgcgtgcgttcctgctgaagaagtaa

DBGET integrated database retrieval system