KEGG   Erwinia pyrifoliae Ep1/96: EpC_07920Help
Entry
EpC_07920         CDS       T01000                                 

Gene name
aceF
Definition
pyruvate dehydrogenase multienzyme complex, dihydrolipoamide acetyltransferase component(E2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EpC_07920 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_07920 (aceF)
   00020 Citrate cycle (TCA cycle)
    EpC_07920 (aceF)
   00620 Pyruvate metabolism
    EpC_07920 (aceF)
Enzymes [BR:epy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EpC_07920 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918869..920467
Genome map
AA seq 532 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDTVEVEQSILVVEGDKASMEVPSPQAGVVKEIKIA
TGDRVETGKLIMIFEAAGDAPAPAVAEEKQEAAPAAAAAAPAAASAAKEVNVPDIGGDEV
EVTEIMVKVGDKVEAEQSILTVEGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLVMVFD
VEGAAPAAAPAAKAEAPAPAAAKQEEKAAPAAAPAKAEAKSEFAENDAYVHATPVIRRLA
REFGVNLAKVKGTGRKSRILKEDVQSYVKDAVKRAEAPAAAGGGMPGMLPWPKVDYSKFG
EVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFT
PVVFIMKAVAAALEQMPRFNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKG
IVELSRELTAISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKS
AMEPVWNGKEFMPRLMMPISLSFDHRVIDGADGARFITIINNTLADIRRLVM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaatgttcctgatatcggggcggacgaagttgaagtcaccgagatc
ctggtcaaggttggcgacacggtagaagttgagcagtcgatactggtagttgaaggcgac
aaagcctcaatggaagtgccttcgccgcaggctggcgtggtgaaagagatcaaaatcgcc
accggcgaccgggttgaaaccggtaaactgattatgatcttcgaagcggctggcgatgcg
cctgcaccggcagtggctgaagagaagcaagaggcggctccggccgctgctgctgcggcc
ccggcggctgccagcgcggcaaaagaagtgaacgtaccggatatcggcggcgacgaagtt
gaagtgaccgagatcatggtcaaagtcggcgacaaggttgaagcggaacagtcgatcctc
accgttgagggcgacaaagcctcaatggaagtgcctgcaccattcgccggtacggttaaa
gagatcaaaatcagcgctggcgataaagtcagcaccggttctctggtaatggtctttgac
gttgagggcgcagcgcctgctgcggctccggcggcgaaagctgaagcgccagcacctgct
gcggctaagcaggaagaaaaagccgctccggcagcggctcctgctaaagcggaagcgaag
tctgaatttgcagaaaacgatgcctacgtgcacgccacgccggttatccgccgtctggcg
cgtgaattcggcgttaacctggcgaaggtcaagggcaccggacgcaaatcacgaattctg
aaagaagacgtgcagagctacgtcaaagacgcggtgaaacgcgccgaagcaccggcggct
gccggtggcggaatgccgggcatgctgccgtggccgaaagtggactacagcaagtttggt
gaagttgaagaagtggagctgggccgcatccagaaaatctctggtgccaacctgagccgt
aactgggtgatgatcccgcacgttacccacttcgacaaaaccgatatcaccgacctggaa
gcgttccgcaaacagcagaacgccgaagcagagaagcgcaagctggacgtgaagttcacc
ccggtggtgttcatcatgaaagccgttgccgctgcgcttgagcaaatgccgcgctttaac
agctcgctgtctgaagatgcgcagaagctgacgctgaaaaaatacatcaacatcggcgtg
gcggttgatacgccaaatggcctggtggtgccggtatttaaagacgtcaacaagaaaggg
attgttgagctgtcgcgtgaactgaccgccatctcgaaaaaagcgcgtgatggcaaacta
accgccggcgaaatgcagggcggctgcttcaccatctccagcattggcggcctggggacg
acccactttgcgccaatcgttaacgcgccggaagtggctatccttggcgtctccaagtcg
gcgatggagccggtgtggaatggtaaagagtttatgccgcgtctgatgatgccgatttcg
ctctccttcgaccaccgcgtgatcgacggtgcggacggtgcgcgcttcattaccatcatt
aataacaccctggccgacatccgccgtctggtgatgtag

DBGET integrated database retrieval system