KEGG   Erwinia pyrifoliae Ep1/96: EpC_07930Help
Entry
EpC_07930         CDS       T01000                                 

Gene name
lpdA
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EpC_07930 (lpdA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_07930 (lpdA)
   00020 Citrate cycle (TCA cycle)
    EpC_07930 (lpdA)
   00620 Pyruvate metabolism
    EpC_07930 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EpC_07930 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    EpC_07930 (lpdA)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     EpC_07930 (lpdA)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EpC_07930 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920760..922187
Genome map
AA seq 475 aa AA seqDB search
MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKSLEAHGIVFGKPQTDIDKVRGWKEKVISQLTGGLAGMAKGRKVNVVNGLGKFT
GANTLEVTAEEGSKTTITFDNAIIAAGSRPIELPFIPHEDPRVWDSTDALELKEVPERLL
VMGGGIIGLEMATVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
AVEAKEDGIYVTMEGKKAPSEPQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDK
QMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKEQGISYETSTFPWAASGRAIASDCADGMTKLIFDKNTHRVIGGAIVGTNGG
ELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaattaaaactcaggtcgtggtacttggggcaggtcctgcaggctactct
gccgccttccgtgcagcggatttaggtctggagaccgttatcgttgagcgctacagcacc
ctgggcggtgtttgtctgaacgttggctgtatcccttctaaagccctgctgcacgttgcc
aaagtgattgaagaagccaaatcgttggaagcacacggcattgtcttcggcaagccgcag
actgatatcgataaagtgcgtggctggaaagaaaaagtcatctctcagctgaccggcggt
ttggccggtatggcgaaaggccgtaaggtcaacgtggttaacggccttggtaaattcacc
ggtgccaacacgctggaagtgaccgcagaagagggttcaaaaaccaccatcactttcgac
aatgcgattatcgccgccggttcgcgtcctattgaactgccgtttattccgcatgaagat
ccgcgcgtttgggattcaaccgatgcgctggagctgaaagaagtgccggaacgcctgctg
gtaatgggcggcggcattatcggcctggaaatggctaccgtttatcatgcgctgggttca
cagatcgacgtggtagagatgtttgatcaggtgatcccggctgcggacaaagacgtggtg
aaagtgttcaccaaacgtatttctaagcagttcaacctgatgctggaaaccaaagtgacc
gccgttgaagcgaaagaagacggtatctatgtcacgatggaaggcaaaaaagcgccgtcc
gaaccccagcgttacgacgcggtgctggtcgccattggtcgcgtacctaacggtaaaggt
ctggacgcgggcaaagccggtgttgaagtcgacgaccgtggctttatccgcgttgataag
cagatgcgtaccaacgtgccgcacattttcgccatcggcgatatcgttggtcagccgatg
ctggcgcacaaaggcgtgcatgaaggccacgtcgcggcagaagtgatctccggtaagaaa
cactacttcgacccgaaagtgatcccgtctatcgcctacaccgagccggaagttgcctgg
gtcggtctgaccgagaaagaagcgaaagagcaaggcatcagctatgaaacgtccaccttc
ccgtgggcagcttcaggccgcgccatcgcttccgactgtgcagacggcatgaccaagctg
atcttcgacaaaaacacccatcgtgtgatcggcggtgcgattgtcggcaccaacggcggc
gagctgctgggtgaaatcggtctggctatcgagatgggctgtgatgcggaagatatcgcg
ctgaccatccacgcgcacccaaccctgcatgaatcggttggcctggcggcggaaatcttc
gaaggcagcattaccgacctgccaaacccgaaagcgaaaaagaaataa

DBGET integrated database retrieval system