KEGG   Erwinia pyrifoliae Ep1/96: EpC_07930Help
Entry
EpC_07930         CDS       T01000                                 

Gene name
lpdA
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:epy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:epy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:epy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:epy00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:epy00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:epy00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920760..922187
Genome map
AA seq 475 aa AA seqDB search
MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKSLEAHGIVFGKPQTDIDKVRGWKEKVISQLTGGLAGMAKGRKVNVVNGLGKFT
GANTLEVTAEEGSKTTITFDNAIIAAGSRPIELPFIPHEDPRVWDSTDALELKEVPERLL
VMGGGIIGLEMATVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
AVEAKEDGIYVTMEGKKAPSEPQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDK
QMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKEQGISYETSTFPWAASGRAIASDCADGMTKLIFDKNTHRVIGGAIVGTNGG
ELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaattaaaactcaggtcgtggtacttggggcaggtcctgcaggctactct
gccgccttccgtgcagcggatttaggtctggagaccgttatcgttgagcgctacagcacc
ctgggcggtgtttgtctgaacgttggctgtatcccttctaaagccctgctgcacgttgcc
aaagtgattgaagaagccaaatcgttggaagcacacggcattgtcttcggcaagccgcag
actgatatcgataaagtgcgtggctggaaagaaaaagtcatctctcagctgaccggcggt
ttggccggtatggcgaaaggccgtaaggtcaacgtggttaacggccttggtaaattcacc
ggtgccaacacgctggaagtgaccgcagaagagggttcaaaaaccaccatcactttcgac
aatgcgattatcgccgccggttcgcgtcctattgaactgccgtttattccgcatgaagat
ccgcgcgtttgggattcaaccgatgcgctggagctgaaagaagtgccggaacgcctgctg
gtaatgggcggcggcattatcggcctggaaatggctaccgtttatcatgcgctgggttca
cagatcgacgtggtagagatgtttgatcaggtgatcccggctgcggacaaagacgtggtg
aaagtgttcaccaaacgtatttctaagcagttcaacctgatgctggaaaccaaagtgacc
gccgttgaagcgaaagaagacggtatctatgtcacgatggaaggcaaaaaagcgccgtcc
gaaccccagcgttacgacgcggtgctggtcgccattggtcgcgtacctaacggtaaaggt
ctggacgcgggcaaagccggtgttgaagtcgacgaccgtggctttatccgcgttgataag
cagatgcgtaccaacgtgccgcacattttcgccatcggcgatatcgttggtcagccgatg
ctggcgcacaaaggcgtgcatgaaggccacgtcgcggcagaagtgatctccggtaagaaa
cactacttcgacccgaaagtgatcccgtctatcgcctacaccgagccggaagttgcctgg
gtcggtctgaccgagaaagaagcgaaagagcaaggcatcagctatgaaacgtccaccttc
ccgtgggcagcttcaggccgcgccatcgcttccgactgtgcagacggcatgaccaagctg
atcttcgacaaaaacacccatcgtgtgatcggcggtgcgattgtcggcaccaacggcggc
gagctgctgggtgaaatcggtctggctatcgagatgggctgtgatgcggaagatatcgcg
ctgaccatccacgcgcacccaaccctgcatgaatcggttggcctggcggcggaaatcttc
gaaggcagcattaccgacctgccaaacccgaaagcgaaaaagaaataa

DBGET integrated database retrieval system