KEGG   Erwinia pyrifoliae Ep1/96: EpC_08010Help
Entry
EpC_08010         CDS       T01000                                 

Definition
(GenBank) Putative thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EpC_08010
   00630 Glyoxylate and dicarboxylate metabolism
    EpC_08010
   00640 Propanoate metabolism
    EpC_08010
   00650 Butanoate metabolism
    EpC_08010
  Lipid metabolism
   00071 Fatty acid degradation
    EpC_08010
   00072 Synthesis and degradation of ketone bodies
    EpC_08010
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EpC_08010
   00310 Lysine degradation
    EpC_08010
   00380 Tryptophan metabolism
    EpC_08010
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EpC_08010
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EpC_08010
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EpC_08010
Enzymes [BR:epy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EpC_08010
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EpC_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
927877..929019
Genome map
AA seq 380 aa AA seqDB search
MIVAARRTPVGRAYGSLASVPPEALLAPLFNKLLPAGMTAIDEVIIGNATGGGGNIARLA
ALAAGVPMTVPAVTVDRQCGSGLEAVINACRLVQARAGECYLAGGVESVSNAPWRVEKPA
TLKQMPRFYPRARFSPDEIGDPDMGIAAENVARQCAISRERQDRFALRSHQRALAAAQQG
AFREEIVPLNLGHCLVENDECPRPGTSLAQLAALPPVFAADGSVTAGNCCPLNDGAALLL
VMSRRRARECGFTQGLLFADACSAGVDPNLLGLGPVPATEKLLRRQPGLTLDGVEVIEFN
EAFAAQVLASVDALGIDEHRINQQGGAIALGHPYGASGAIMVTRLFSQLVSQRQSEGYGL
AMLGIAGGLGLSALFKGVQL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtggccgcccgccgtactcctgtcggcagggcttatggttctctggccagcgtg
ccgccggaggcgctgctggccccgctgtttaacaaactgctgccagcaggtatgacggcg
attgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcgcggctggcg
gcgctggcggcgggcgtgccgatgaccgtgcctgccgtaacggtggacaggcagtgcggc
tccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggcgggcgaatgc
tatctggccggcggcgtagagagcgtcagcaacgcgccctggcgggtggagaagcccgcc
acgctaaagcagatgccgcgcttttaccctcgtgcacgtttttcaccggatgagatcggc
gatccggacatgggcatcgccgcggaaaacgtcgcgcgtcagtgcgccatcagccgggaa
cgccaggatcgctttgcgctgcgcagccaccagcgcgcgctggccgccgcgcagcagggc
gcattccgtgaggagatcgtcccgcttaacctgggccattgcctggtcgaaaatgacgag
tgcccgcgccccggcacctcgctggcgcagctggcggcattaccgccggtatttgccgcc
gatggctcggtgacggcgggtaactgctgtccgctgaatgacggggctgcgctgctgctg
gtgatgagccgacgcagggcgcgggagtgcggatttacccaggggctgctgtttgccgat
gcctgtagcgcaggcgttgacccgaatttacttggcctcggcccggttcccgccacggaa
aaactgctgcggcgtcagccgggcctgacgctggacggggttgaggtcattgagttcaat
gaagcctttgccgcccaggtgctggcatcggttgatgcactgggtatagatgaacacagg
atcaaccagcaggggggcgctattgctttggggcatccgtacggcgcttccggggcgata
atggtgacgcggctgttcagccagctggtcagccagcggcagagcgaaggctacggcctg
gcgatgctgggaatagctggcgggctggggctgagcgcattgtttaagggcgtgcagctg
taa

DBGET integrated database retrieval system