KEGG   Erwinia pyrifoliae Ep1/96: EpC_10410Help
Entry
EpC_10410         CDS       T01000                                 

Gene name
sseA
Definition
3-mercaptopyruvate sulfurtransferase (EC:2.8.1.2)
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:epy00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:epy00270]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:epy04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196128..1197045)
Genome map
AA seq 305 aa AA seqDB search
MIAKKIADTASNVTDNEAAMTTPSFFVSADWLAQHLSDNDLQMLDARMLPPGQEKTRDVH
AEYLAAHLPGAPFFNIEALSDHTSPYPHMMPRAESFAVAMRELGINSAKHLVVYDEGNLF
SAPRAWWMLRYFGVERVSILAGGLAGWQKAQLPLSSGAVDVAEAEFEAVVGYGEIKRTTD
VLLVSHEGGAQIVDARAANRFHGEVDEPRPGLHRGRIPGSLNVAWNTLVACGRLKPADEL
RAIFSQQGVDLAQPVIASCGSGVTAAVVILALASLGVKNIALYDGSWGEWGSRNDLPIIN
DALSA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgatagcgaaaaaaatcgctgacactgcgtcaaacgtgactgacaatgaggcagcaatg
accacaccttctttttttgtatccgccgactggctggcacagcatctgagcgataacgac
ctgcagatgctggatgcccgtatgctgcctcccgggcaggaaaaaacacgcgacgtccac
gccgaatatctggcagctcacctgccgggtgcaccgtttttcaatattgaagcgctgtcc
gatcacaccagcccttacccacatatgatgccgcgcgccgagagctttgcggtagcgatg
cgcgagctgggcattaacagtgctaaacatctggtggtgtacgacgaaggcaatctgttt
tcagccccgcgcgcgtggtggatgctgcgctattttggcgtggagcgggtatcgatcctg
gccggcgggttggctggctggcaaaaagcgcagctgccgctgtccagtggcgcggtcgat
gtggcagaagcggagtttgaagcggttgtgggctacggcgagatcaagcgcacaaccgac
gtgctgctggtcagccatgagggcggtgcgcagattgttgatgcccgcgccgccaaccgc
tttcacggagaagtcgatgagccgcgtcccggcctgcatcgtggccgtattcctggcagc
ctgaacgttgcctggaacacgctggtcgcctgcgggcggttaaaacccgccgacgaactg
cgggcaatcttcagtcaacagggcgtggacctggcgcagccggtgatcgccagctgcggt
tctggcgttacggcggcggtggtgattctggcattagccagcctcggggtgaaaaacatc
gcgctgtatgacggttcctggggtgaatggggcagccgtaatgacctgccaatcatcaat
gatgcgttatcggcctga

DBGET integrated database retrieval system