KEGG   Erwinia pyrifoliae Ep1/96: EpC_10410Help
Entry
EpC_10410         CDS       T01000                                 

Gene name
sseA
Definition
3-mercaptopyruvate sulfurtransferase (EC:2.8.1.2)
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EpC_10410 (sseA)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EpC_10410 (sseA)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    EpC_10410 (sseA)
Enzymes [BR:epy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     EpC_10410 (sseA)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     EpC_10410 (sseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196128..1197045)
Genome map
AA seq 305 aa AA seqDB search
MIAKKIADTASNVTDNEAAMTTPSFFVSADWLAQHLSDNDLQMLDARMLPPGQEKTRDVH
AEYLAAHLPGAPFFNIEALSDHTSPYPHMMPRAESFAVAMRELGINSAKHLVVYDEGNLF
SAPRAWWMLRYFGVERVSILAGGLAGWQKAQLPLSSGAVDVAEAEFEAVVGYGEIKRTTD
VLLVSHEGGAQIVDARAANRFHGEVDEPRPGLHRGRIPGSLNVAWNTLVACGRLKPADEL
RAIFSQQGVDLAQPVIASCGSGVTAAVVILALASLGVKNIALYDGSWGEWGSRNDLPIIN
DALSA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgatagcgaaaaaaatcgctgacactgcgtcaaacgtgactgacaatgaggcagcaatg
accacaccttctttttttgtatccgccgactggctggcacagcatctgagcgataacgac
ctgcagatgctggatgcccgtatgctgcctcccgggcaggaaaaaacacgcgacgtccac
gccgaatatctggcagctcacctgccgggtgcaccgtttttcaatattgaagcgctgtcc
gatcacaccagcccttacccacatatgatgccgcgcgccgagagctttgcggtagcgatg
cgcgagctgggcattaacagtgctaaacatctggtggtgtacgacgaaggcaatctgttt
tcagccccgcgcgcgtggtggatgctgcgctattttggcgtggagcgggtatcgatcctg
gccggcgggttggctggctggcaaaaagcgcagctgccgctgtccagtggcgcggtcgat
gtggcagaagcggagtttgaagcggttgtgggctacggcgagatcaagcgcacaaccgac
gtgctgctggtcagccatgagggcggtgcgcagattgttgatgcccgcgccgccaaccgc
tttcacggagaagtcgatgagccgcgtcccggcctgcatcgtggccgtattcctggcagc
ctgaacgttgcctggaacacgctggtcgcctgcgggcggttaaaacccgccgacgaactg
cgggcaatcttcagtcaacagggcgtggacctggcgcagccggtgatcgccagctgcggt
tctggcgttacggcggcggtggtgattctggcattagccagcctcggggtgaaaaacatc
gcgctgtatgacggttcctggggtgaatggggcagccgtaatgacctgccaatcatcaat
gatgcgttatcggcctga

DBGET integrated database retrieval system