KEGG   Erwinia pyrifoliae Ep1/96: EpC_11620Help
Entry
EpC_11620         CDS       T01000                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00010  Glycolysis / Gluconeogenesis
epy00052  Galactose metabolism
epy00500  Starch and sucrose metabolism
epy00520  Amino sugar and nucleotide sugar metabolism
epy00521  Streptomycin biosynthesis
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
Module
epy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
epy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_11620 (glk)
   00052 Galactose metabolism
    EpC_11620 (glk)
   00500 Starch and sucrose metabolism
    EpC_11620 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EpC_11620 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EpC_11620 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EpC_11620 (glk)
Enzymes [BR:epy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EpC_11620 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CAX54941
Position
1349632..1350597
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEIENGAISQAKTFSTADYGSLEAVIRAYLAEQQQDIKHGC
IAIACPITEDWVEMTNHDWAFSTSSLKANLAFDSLEIINDFTAVSMAIPMLTEQDLMQFG
GSVPVADKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLREE
LGHVSAERILSGSGLVNLYRAIVKSDHRLPENLKPRDVTERALQDTCTDCRRALSMFCVA
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYVAPIPVYLIT
HNYPGLLGAGGHLRQTLGRVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtgggggatgtcggcggcacgaatgcgcgcctggcactatgt
gaaattgaaaacggtgccatctcccaggccaaaacgttctccactgccgattatggcagc
ctggaggcggtgatccgtgcttatctggcggaacaacagcaggatatcaaacacggttgt
attgccatcgcctgcccgattaccgaagactgggttgaaatgaccaaccatgactgggca
ttttcaaccagtagcctgaaagcgaacctggcctttgattcgctggagatcattaacgat
tttaccgccgtctcaatggccatcccgatgctgacagagcaagatctgatgcagttcggt
ggcagcgtgccggtagcggataaacccgttgccgtttatggtgccggaaccggcctcggc
gttgcgcatctggtgcatgtggacaaacgctgggtcagtctgcctggcgaaggggggcat
gttgattttgccgccaatagcgaggaagaagatctgatacttgaagtgctgcgcgaagag
ttgggccacgtatccgccgagcgaattctctccggcagcggcctggttaacctctatcgg
gcgattgttaagtcagaccatcgcctgccagaaaatctgaaaccacgcgatgtgaccgag
cgcgcattgcaggacacctgtaccgactgccgtcgggcgctgtcgatgttctgtgtggct
atggggcgctttggcggcaacctggcgcttaacctcggcacctttggcggcgtctatatt
gccggcggcatcgtgccgcgcttccttgaattctttaaagcatccggcttccgcgcggcg
tttgaagataaggggcgcttcaaggattatgtcgcgccaatcccggtctatctcatcacc
cacaattatcctgggttactgggtgccggcgggcatctgcgtcagacgctgggccgcgtg
ctgtaa

DBGET integrated database retrieval system