KEGG   Erwinia pyrifoliae Ep1/96: EpC_12010Help
Entry
EpC_12010         CDS       T01000                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00071  Fatty acid degradation
epy00280  Valine, leucine and isoleucine degradation
epy00281  Geraniol degradation
epy00310  Lysine degradation
epy00362  Benzoate degradation
epy00380  Tryptophan metabolism
epy00410  beta-Alanine metabolism
epy00640  Propanoate metabolism
epy00650  Butanoate metabolism
epy00903  Limonene and pinene degradation
epy00930  Caprolactam degradation
epy01040  Biosynthesis of unsaturated fatty acids
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
epy01212  Fatty acid metabolism
Module
epy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EpC_12010 (fadJ)
   00650 Butanoate metabolism
    EpC_12010 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EpC_12010 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EpC_12010 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EpC_12010 (fadJ)
   00310 Lysine degradation
    EpC_12010 (fadJ)
   00380 Tryptophan metabolism
    EpC_12010 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EpC_12010 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EpC_12010 (fadJ)
   00281 Geraniol degradation
    EpC_12010 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EpC_12010 (fadJ)
   00930 Caprolactam degradation
    EpC_12010 (fadJ)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EpC_12010 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EpC_12010 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EpC_12010 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DVL
Motif
Other DBs
NCBI-ProteinID: CAX54980
Position
1389763..1391910
Genome map
AA seq 715 aa AA seqDB search
MDLPSALTLTLRPDRVGVITIDVPYEKVNTLKAEFAADILALVQQARANPHLAGLVLISG
KPDSFIAGADINMIAACHSVQQATALAQAGQKAMAEIAALPFPVVAAIHGACLGGGLELA
LACHRRICTQDDKTRLGLPEVQLGLLPGSGGTQRLPGVTGIRVALDMILTGKTLGARAAL
RCGLVDETVDHAILLEAAVQRVLQPLAAAKPLPFSERLLTRAPGRSLLFMLAQRRTRSKT
HGNYPATEKILSVVRCGLTPGSNGYLAEAQAFGELVMTPQSAALRSLFFANTALKKAHFG
VEPHELKRIGILGGGLMGGGIACVTATRAGLPVRIKDVNANGINHALKTSWQVLTRAVER
RRLSAAQRQQQMALITGSTDYQGFRQCDMVIEAVFEDLALKQKMVAEIEANCSVQTLFAS
NTSSLPIADIAAAAQRPENVIGLHYFSPPEKMPLVEVIPHAGTSRETLATAVMLARKQGK
TPIVVADRAGFYVNRILAPYIIEALHCLLEGEPVEYIDRSLVQFGFPLGPLQLLDEVGLD
VGTQIMPILQHAWGERFALPAGLEALWQDGRKGRKNGRGFYLYQQKGRKKRVDSTLYRLL
PVKVKQHLSAAHIAQRCVMMLLNEAARTLDEQGIASARDGDIGAVLGIGFPPFLGGPFRY
MDQLGIGEVVNRLTLLVQQHGSRFAPCSLLEKMAVEGKTFYQSDVKSDKPADSAG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccatctgcattgactcttactctgcgcccggatcgggtcggcgtcatcacc
atcgatgtaccgtatgagaaggttaacaccctgaaagctgaatttgccgcagatattctg
gcgcttgtccagcaggcgcgggccaacccgcatctggccgggctggtactgatttccggt
aagcccgacagttttatcgccggggcggatatcaacatgatcgccgcctgtcatagcgta
cagcaggcgaccgcattggctcaggccggtcaaaaggcgatggcggagatagccgcactg
ccgtttccggtcgtcgcggcgatccacggtgcctgccttggcggcgggcttgaactggcg
ctggcctgccatcgccgcatctgtacgcaggatgacaaaacccggcttggcttaccggaa
gttcagctgggcctgctgccgggttccggcgggacgcagcgcctgccgggcgtgacgggc
atccgggtggcactggatatgatattgacgggcaaaacgctgggggcgcgtgccgcatta
cgctgcgggctggtggacgagacggtggatcacgctattctgctggaagcggcggtacag
cgggtgctacaaccgcttgcggcagcgaagcctttaccctttagcgaacggctgttaacc
cgcgcgcccggccgctcgctgctgtttatgctcgcacagcgccggacgcggtcgaaaacc
cacggcaactatccggctacggaaaaaattctcagcgtggtgcgctgcgggctgacgcca
ggcagcaacggctatttagccgaagcacaggcctttggtgaactggtgatgaccccgcag
tctgccgcgctgcgcagcctgttttttgccaacactgcgctaaaaaaagcgcattttggt
gttgaaccccatgaactgaaacgcattggcatactgggcggtggcctgatgggcgggggg
attgcctgcgttactgcgacgcgtgccgggttgccggtgcgcatcaaagacgtcaatgcc
aacggcattaaccatgcgctgaaaaccagctggcaggtgctgacccgcgcggtggagcgc
cgccgcctgagtgcggcacagcgccagcagcagatggcattaatcaccggcagcaccgat
taccagggcttccggcagtgcgatatggtcatcgaagcggtatttgaagacctggcgctg
aagcagaaaatggtggcggaaatcgaagcgaactgtagcgtacaaacgctgtttgcctcc
aatacctcttcgttgccgatagcggatattgccgccgccgcgcagcggccagagaacgtt
atcggcctgcattacttcagcccaccggagaaaatgccgctggtggaggtgatcccgcat
gcgggcacctccagagaaaccctcgccacagcggtgatgctggcacgaaaacagggcaag
acgccaatcgtcgtcgccgaccgggcgggcttctacgttaaccgtattcttgccccctat
attatcgaagcgctgcactgcctgctggagggggagccggttgaatatatcgaccggtcg
ctggtgcagttcggtttcccgcttggcccgttacagctgctggacgaggtcgggctggat
gtgggtacacagattatgccgatccttcaacatgcatggggcgaacgtttcgcgctgcca
gcgggactggaagcgctatggcaggatgggcgcaaaggacggaaaaacgggcgcgggttc
tatttgtatcaacagaaaggcagaaaaaaacgcgtcgacagcacgctgtaccgcctgctg
cccgtcaaggtaaaacagcatcttagcgcggcgcatatcgcccaacgctgtgtgatgatg
ttgttgaatgaggcagcacgaacgctggatgagcaggggatcgccagcgcgcgcgatggt
gatatcggcgcggtattgggcattggctttccgccttttcttggcgggccgttccgctat
atggaccagttgggtatcggtgaagtggtcaatcgtttaacgctgcttgtgcagcagcac
ggttcgcgttttgcgccttgttcactgctggaaaaaatggcggttgaaggcaaaaccttt
tatcaaagcgatgttaaatctgacaaacccgccgattcagctggttag

DBGET integrated database retrieval system