KEGG   Erwinia pyrifoliae Ep1/96: EpC_13970Help
Entry
EpC_13970         CDS       T01000                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EpC_13970 (galF)
   00052 Galactose metabolism
    EpC_13970 (galF)
   00500 Starch and sucrose metabolism
    EpC_13970 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EpC_13970 (galF)
Enzymes [BR:epy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EpC_13970 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606879..1607775
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHLLPATKAIPKEMLPIVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLADALLCARPM
LHDEAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPEADLSEYSVITT
EESLDFPGKVSSILDFVEKPENPEMLNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLT
DAIASLNKKMPVDAQLLSGDSFDCGRKLGYMKAFVTWGLRNHSQGREFRDEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctgaaagcagttataccggttgcgggtctcggaatgcatctgctccctgcg
acaaaagctattcctaaagagatgttgcccatagtcgataagccaatgattcaatacatc
attgatgagtgcgtggcggcgggtataaaggaaatcgttctggtcacccatgcatccaag
aatgcggttgaaaaccattttgatacttcctatgaacttgaagccttgcttgaagcccgc
gttaaacgctccctgctgagtgaggtaaaatcgatctgcccaccaggtgtaacgattatg
aacgtgcgccaaccccagccgctggggcttgccgatgctttgctgtgcgcccgtccaatg
ctgcatgatgaggcgtttgtggtggtgctgcctgatgtgctgctggataatgccagcgcc
gatccgttgcgctacaacctggcggcgatggtagcacgttttgaagaaaccggacgtagt
caggtgctggctcatcacatgccggaagccgatctttcagagtactccgtgattaccact
gaggagtcattggacttccctggcaaagtcagctccattctggatttcgttgaaaaaccc
gaaaacccagagatgctgaactccgatcttgccgctgtggggcgctatgtgttatcagcc
gatatttggcccgagctggaagcgctggagccgggtgcgtgggggcgctaccagttaacc
gatgccatcgccagcttaaacaagaagatgcctgtagatgctcaattgctcagtggcgat
agctttgattgcggacgtaaacttggttatatgaaagccttcgttacctggggcttgcgt
aaccatagtcaggggcgtgagttccgcgacgagatccagaaaatcctggcgaaataa

DBGET integrated database retrieval system