KEGG   Erwinia pyrifoliae Ep1/96: EpC_13970Help
Entry
EpC_13970         CDS       T01000                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EpC_13970 (galF)
   00052 Galactose metabolism
    EpC_13970 (galF)
   00500 Starch and sucrose metabolism
    EpC_13970 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EpC_13970 (galF)
Enzymes [BR:epy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EpC_13970 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606879..1607775
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHLLPATKAIPKEMLPIVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLADALLCARPM
LHDEAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPEADLSEYSVITT
EESLDFPGKVSSILDFVEKPENPEMLNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLT
DAIASLNKKMPVDAQLLSGDSFDCGRKLGYMKAFVTWGLRNHSQGREFRDEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctgaaagcagttataccggttgcgggtctcggaatgcatctgctccctgcg
acaaaagctattcctaaagagatgttgcccatagtcgataagccaatgattcaatacatc
attgatgagtgcgtggcggcgggtataaaggaaatcgttctggtcacccatgcatccaag
aatgcggttgaaaaccattttgatacttcctatgaacttgaagccttgcttgaagcccgc
gttaaacgctccctgctgagtgaggtaaaatcgatctgcccaccaggtgtaacgattatg
aacgtgcgccaaccccagccgctggggcttgccgatgctttgctgtgcgcccgtccaatg
ctgcatgatgaggcgtttgtggtggtgctgcctgatgtgctgctggataatgccagcgcc
gatccgttgcgctacaacctggcggcgatggtagcacgttttgaagaaaccggacgtagt
caggtgctggctcatcacatgccggaagccgatctttcagagtactccgtgattaccact
gaggagtcattggacttccctggcaaagtcagctccattctggatttcgttgaaaaaccc
gaaaacccagagatgctgaactccgatcttgccgctgtggggcgctatgtgttatcagcc
gatatttggcccgagctggaagcgctggagccgggtgcgtgggggcgctaccagttaacc
gatgccatcgccagcttaaacaagaagatgcctgtagatgctcaattgctcagtggcgat
agctttgattgcggacgtaaacttggttatatgaaagccttcgttacctggggcttgcgt
aaccatagtcaggggcgtgagttccgcgacgagatccagaaaatcctggcgaaataa

DBGET integrated database retrieval system