KEGG   Erwinia pyrifoliae Ep1/96: EpC_15230Help
Entry
EpC_15230         CDS       T01000                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:epy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738029..1739006
Genome map
AA seq 325 aa AA seqDB search
MSSYFPIQRPRRLRHSASLRSLFQENTLSLNDLALPIFVEEGLDDYKPIAAMPGVMRIPE
KRLAYEIERIAKAGVRSVMTFGISHHTDADGSDTWNENGLVARMSRICKQTVPEMIVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLKNLGRQAVVAAAAGADFIAPSAAMDGQVAAIRHA
LDAAGFTDTAIMSYSTKFASSFYGPFREAAGTSLKGDRKTYQMNPMNRREAIRESLIDEA
EGADALMVKPAGAYLDILREVRDRTQLPLAAYQVSGEYAMIKFGAQAGAISETEVVLESL
GAIKRAGADIIFSYFALDLAEKNIL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgtccagctattttcctatccagcgtccacgacgcctgcgtcattccgcttctcttcgc
tctctgtttcaggaaaacaccctcagtctgaacgatctggcgctgccgatctttgttgag
gaaggccttgacgactataagccgattgctgccatgccgggggtgatgcgcattccggaa
aagcgcctggcgtatgagattgaacgtattgccaaagcgggcgtgcggtcggtgatgacc
ttcggtatttctcaccataccgatgctgacggcagcgatacctggaacgagaacgggctg
gtggcgcgtatgtcacgtatttgcaaacagacggtgccggaaatgattgtgatgtccgat
acctgtttttgtgagtataccagccacggccactgcggcgtgctgcatgaccacggcgtg
gataatgacgccacgctaaaaaaccttggcaggcaggcggtggtggccgccgcagcaggg
gctgattttatcgcgccgtcggcggcaatggacggccaggtggcggcgatccgtcacgcg
ctggatgcggctggctttaccgataccgccatcatgtcctattctaccaagttcgcctcc
tccttctacggcccgttccgcgaagcggcaggcacctcgctgaaaggcgatcgcaaaacc
taccagatgaatccgatgaaccgccgcgaagcgattcgtgaatcgctgatcgacgaagcg
gaaggggcggatgcgctgatggttaaaccggcgggtgcctatctggatattctgcgcgaa
gtacgtgaccgcacccaactgccgctggcggcctatcaggtgagcggtgagtacgcgatg
attaagttcggtgcgcaggcgggtgccattagcgaaaccgaagtggtgctggaaagcctg
ggggcgatcaaacgcgccggtgccgatattattttcagctactttgctcttgacctcgcc
gagaagaatattctctga

DBGET integrated database retrieval system