KEGG   Erwinia pyrifoliae Ep1/96: EpC_16350Help
Entry
EpC_16350         CDS       T01000                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:epy00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1859482..1860096)
Genome map
AA seq 204 aa AA seqDB search
MSIRQALLLIDLQNDFCPGGALAVSEGDQTIAVANRLAADFQRRGETVIATLDWHPAGHG
SFASNAGTIVGTQGDLNGLPQIWWPDHCVQHSHGAQLHPLLDRAAISLLVHKGENAEIDS
YSAFYDNGQRHQTLLHGWLSELGITALTVMGLATDYCVKFSVLDALALGYRVTVVTAGCR
GVNLHPDDSDNALLSMTQAGAILI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcatacgtcaggcactattattgatagacctgcaaaatgacttttgtcccggcggg
gcgttggccgtcagcgaaggggatcagaccattgccgtcgctaaccgccttgctgccgat
ttccagcggcgtggcgagacggtgatcgccaccctcgactggcatcctgcagggcatggc
agttttgcctccaacgccgggactatagtgggaacccagggcgatttaaacggcttaccc
cagatctggtggccggatcattgcgtgcagcatagccacggtgcgcagctgcatcctttg
ctcgatcgcgcggcaatcagcctgctggtgcacaaaggtgagaatgcagaaattgatagc
tacagtgcattttatgataatggccagcgccatcagacgctgttacacggctggctgagt
gagcttggcattactgccctgaccgtaatgggcctggcgaccgattactgcgtgaaattt
agcgtgctggacgcactggctctgggctaccgggtgacggtggtgacagcaggctgccgg
ggcgttaatctgcatcctgacgacagtgacaatgccctgctatctatgactcaggcaggt
gcgatcctcatttaa

DBGET integrated database retrieval system