KEGG   Erwinia pyrifoliae Ep1/96: EpC_16450Help
Entry
EpC_16450         CDS       T01000                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:epy00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:epy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:epy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:epy00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1871042..1871950
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVSDVTAYGV
VDCQGAQLSPGDSAPMVGVVEKPKADKAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGASHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgctggtttgggaacg
cgtatgttgcctgctaccaaagcgattccgaaagagatgttgccactggttgataagccg
ttgattcagtatgtcgttaacgagtgtattgctgctgggatcaacgaaatcgtgctggtt
acgcactcttccaagaactcaattgaaaaccacttcgacaccagcttcgagctggaagcc
atgctggaaaaacgtgttaaacgtcagctgctggaagagattcagtcaatctgtccacca
cacgttaccattatgcaggttcgtcaggggctggctaaaggtcttggccatgcggttatg
tgtgcatggccggtcattggtaacgagccggtagccgttatcctgccggatgttattctg
gatgaatacgaatcagatctgtcgaaagataacctggcagaaatgattcgccgcttcgat
gaaaccggccacagccagatcatggttgaacccgtttctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcaattaagcccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacctaaagccgataaagccccttcaaatctggcagtcgtcgggcgttacgtgctg
tctgctgatatctggccactgctggctaaaactcctccaggtgccggtgatgaaatccag
ctgaccgactcaatcgctatgctgatggagaaagagacggtagaagcttatcacctgaag
ggtgccagccatgactgtggtaacaagctcggctatatgcaggctttcgttgaatatggt
gtgcgtcacgaaactctgggcagcgatttcaaagcctggctggaaagcgctgtgggtaac
aaaaagtaa

DBGET integrated database retrieval system