KEGG   Erwinia pyrifoliae Ep1/96: EpC_16740Help
Entry
EpC_16740         CDS       T01000                                 

Gene name
trpE
Definition
anthranilate synthase component I (EC:4.1.3.27)
Orthology
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:epy01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:epy00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1898752..1900314)
Genome map
AA seq 520 aa AA seqDB search
MPNAKPGVKLITASAPYREDPAAVFHQLCAARSETLLLESADVDSKCNLKSLLIVDSALR
ISALNNRVHIQALSANGCALLPLLDAALPSTVINQIRPESRELVFPLNEEIQDEDANLRA
LSVFDALRLIPGLVNSPQEEREAMLLGGLFAYDLVAGFETLPELDNQQRCPDYCFYLAET
LLVIDHQTRSARLQASLFTPEATEFLRLQSRVEQLCGMMSQPVSALPVQKVDSMQLSVSQ
SDEEYCAIVRQMQEAIRIGEIFQVVPSRRFSLPCPSPLAAYDTLKNSNPSPYMFFMQDRD
FSLFGASPESSLKYAAASNQIEIYPIAGTRPRGRHADGSLDRDLDSRIELEMRTDHKEMA
EHLMLVDLARNDLARICQPGTRYVADLTKVDRYTFVMHLVSRVVGQLRSDIDVLHAYRAC
MNMGTLSGAPKVRAMQLIAKAEGTRRGSYGGAVGYFTASGDLDTCIVIRSAYVEDGVATV
QAGAGVVLDSCPQAEADESRNKARAVLRAIATAHHCREIF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatgccaaacctggagtgaagttgattaccgccagtgcaccgtaccgggaagat
ccggctgcggttttccatcagctctgcgcggcacgttcagagacgctgctgctggaatct
gccgatgtcgacagtaaatgcaatctgaaaagcctgctgattgttgacagcgccctgcgc
atcagcgcactgaataatcgcgtgcacatccaggcgctgtcggccaacggttgtgcgctg
ctgccgttactggatgccgcgctgccctcgacggtaatcaaccagatacgtcctgagagt
cgggaactggtgttcccgctcaatgaagaaatccaggatgaagacgctaacctgcgcgcc
ctgtcagtatttgatgcgctgcgcctgatccccgggctggtcaattctcctcaggaggag
cgtgaggcgatgctgcttggcgggctgtttgcctatgacctggtcgccggctttgaaacg
ctgccggagcttgataaccagcagcgctgcccggactactgtttttatctggcggaaacg
ctgctggtcatcgaccaccagacacggagcgctcgcctgcaggccagcctgtttaccccg
gaagcgactgagtttctgcgtttgcagagccgtgtagaacagctgtgcggcatgatgtct
caacctgtcagcgccttaccggtgcaaaaggtggacagtatgcagcttagcgtcagtcag
agcgatgaagagtactgcgccattgtgcgccagatgcaggaggctatccgtatcggtgaa
attttccaggttgtgccatcgcgccgcttctctctgccttgcccttccccgctggccgct
tacgacacgctgaaaaacagtaaccccagcccgtatatgttctttatgcaggatcgtgac
tttagcctgttcggtgcctcgccggagagttcgctgaagtacgcagccgccagcaatcaa
atcgaaatctacccgattgccggaacgcgcccgcgtggccgtcacgcagacggctcgctc
gatcgcgatctcgacagccgcatagagcttgaaatgcgtaccgatcataaagagatggcc
gaacatctgatgctggtcgatctggcgcgtaacgatctggcacgtatctgccagcccggt
acgcgctatgttgccgacctgacaaaggtcgatcgctacaccttcgttatgcacctggtt
tcgcgcgttgttggccagctgcgcagcgatattgatgtgctgcacgcttatcgcgcctgt
atgaacatgggcacgctgagcggtgcgccgaaagtgcgcgccatgcagctgattgccaaa
gccgaaggcacgcggcgcggcagctatggcggcgcggtaggctactttactgccagcggc
gatctcgacacctgtattgttatccgctccgcgtacgttgaagacggcgtggcaacggtg
caggccggggctggcgtggtgctggactcctgtccgcaggcggaagcggatgaaagccgc
aataaagcgcgggcggttttgcgcgccatcgccactgctcatcactgccgggagattttc
tga

DBGET integrated database retrieval system