KEGG   Erwinia pyrifoliae Ep1/96: EpC_24170Help
Entry
EpC_24170         CDS       T01000                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EpC_24170 (gpmA)
   01230 Biosynthesis of amino acids
    EpC_24170 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_24170 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EpC_24170 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EpC_24170 (gpmA)
Enzymes [BR:epy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EpC_24170 (gpmA)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EpC_24170 (gpmA)
  Exosomal proteins of melanoma cells
   EpC_24170 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2678161..2678913
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLSAEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIRHYYLGDADEIAAKA
ADVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggttttaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtagagaagtcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggttaagcagtggcgtcgtggctttgcc
gttaccccacctgagctggatcgtgccgatgagcgtttccccggtcacgatcctcgctat
gcttcgttgtccgctgaacagttgccgacgaccgaaagcctggcgctgaccattgaccgc
gtgctgccatactggaatgaatctattctgccgcgtatgaaaagcggagagaaagtgatc
attgccgcgcacggtaactccttgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaatatcccgactggcgtaccgctggtctatgagttcgatgaa
aactttaagccgatcagacactactacctgggcgatgcagatgaaatcgccgctaaggca
gctgacgtagctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system