KEGG   Erwinia pyrifoliae Ep1/96: EpC_24410Help
Entry
EpC_24410         CDS       T01000                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00020  Citrate cycle (TCA cycle)
epy00190  Oxidative phosphorylation
epy00650  Butanoate metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
Module
epy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
epy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
epy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EpC_24410 (sdhD)
   00650 Butanoate metabolism
    EpC_24410 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EpC_24410 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAX56220
Position
complement(2712354..2712701)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGSLTYDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaacggcattcatgactggctgctgctgcgt
gccgccgctatgataatgaccctttacgtgttgtatatcctcgcttttatcgtcatgtca
ggctccctgacctatgatatctggcgtggtttttttgcctcatcctttactaaagtcttc
acccttctgacgctgttctccatcctggtgcacggctggattgggatgtggcaggtactg
accgactatatcaaaccactggcgctacgcatgatgctgcagctggtcgtcgtggtagca
ctgttggtgtatgccatttatggaactgttgtagtgtggggtgcataa

DBGET integrated database retrieval system