KEGG   Erwinia pyrifoliae Ep1/96: EpC_25500Help
Entry
EpC_25500         CDS       T01000                                 

Gene name
adhP
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00010  Glycolysis / Gluconeogenesis
epy00071  Fatty acid degradation
epy00350  Tyrosine metabolism
epy00625  Chloroalkane and chloroalkene degradation
epy00626  Naphthalene degradation
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_25500 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EpC_25500 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EpC_25500 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EpC_25500 (adhP)
   00626 Naphthalene degradation
    EpC_25500 (adhP)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EpC_25500 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 2-Hacid_dh_C TgMIC1 Urocanase
Motif
Other DBs
NCBI-ProteinID: CAX56329
Position
2823580..2824596
Genome map
AA seq 338 aa AA seqDB search
MKAAVVTHDHQVDVVEKTLRALQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKSVGPGVTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCREVINAGYTADGGMAEE
CIVVADYAVKVPDGLDPAVASSITCAGVTTYKAVKISGISPGKWLVVYGLGGLGNLALQY
AKNVFNAKVIAVDVSDAQLKFAEEMGADMVINSRNEDAARLIQQRTGGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTRRPLQDINAIFHEMESGKIVGRMVIDFNSTH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcactcacgatcatcaggttgatgtggtagagaaaaccctccgc
gcgctgcagcatggcgaagccctgctcactatggagtgttgcggggtctgtcacaccgac
ctgcacgtcaaaaacggagatttcggcgataaaaccggcgttatccttgggcacgaaggg
attggcgtagtcaaatctgtcggtccgggcgtgacctccctcaagcccggcgaccgtgcc
agcgtggcgtggtttttcaaaggctgcggccattgtgaatactgcaacagcggcaatgaa
accctgtgccgagaggtgatcaacgccggttataccgccgatggcggcatggccgaagag
tgtatcgtggtggcggattatgccgttaaggtgcctgacggtctcgatcctgcggtcgcc
agcagcattacctgcgccggtgtcactacctacaaggcggtgaaaatctccggtatttct
cccggaaaatggctggttgtctatggccttggcggtctgggcaatctggcgctgcagtac
gcaaaaaatgtgtttaatgccaaagtcatcgccgttgacgtcagcgatgcccagctgaaa
tttgccgaagagatgggggccgatatggtgatcaactcgcgtaatgaagacgcggcacgg
ctgatccagcaacgcacggggggcgcacatgctgccgtggtaacagccgttgccaaagcg
gcgtttaattctgcggtggatgcgatgcgcgcaggtggccgtattgtggcagtgggcctg
ccgccggaatcgatgagcctgaatatcccgcgtctggtgctggacggcatccaggtcgtc
ggctcgctggtcggcacgcgtgaagatttagctgaagctttccagttcgcggctgaaggc
aaagttgtacccaaagtcactcgccgcccgctgcaggacatcaacgcgatcttccatgaa
atggaaagcggaaaaatcgttggccgcatggtgattgattttaacagtacccattaa

DBGET integrated database retrieval system