KEGG   Erwinia pyrifoliae Ep1/96: EpC_25500Help
Entry
EpC_25500         CDS       T01000                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EpC_25500 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_25500 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EpC_25500 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EpC_25500 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EpC_25500 (adhP)
   00626 Naphthalene degradation
    EpC_25500 (adhP)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EpC_25500 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2823580..2824596
Genome map
AA seq 338 aa AA seqDB search
MKAAVVTHDHQVDVVEKTLRALQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKSVGPGVTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCREVINAGYTADGGMAEE
CIVVADYAVKVPDGLDPAVASSITCAGVTTYKAVKISGISPGKWLVVYGLGGLGNLALQY
AKNVFNAKVIAVDVSDAQLKFAEEMGADMVINSRNEDAARLIQQRTGGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTRRPLQDINAIFHEMESGKIVGRMVIDFNSTH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcactcacgatcatcaggttgatgtggtagagaaaaccctccgc
gcgctgcagcatggcgaagccctgctcactatggagtgttgcggggtctgtcacaccgac
ctgcacgtcaaaaacggagatttcggcgataaaaccggcgttatccttgggcacgaaggg
attggcgtagtcaaatctgtcggtccgggcgtgacctccctcaagcccggcgaccgtgcc
agcgtggcgtggtttttcaaaggctgcggccattgtgaatactgcaacagcggcaatgaa
accctgtgccgagaggtgatcaacgccggttataccgccgatggcggcatggccgaagag
tgtatcgtggtggcggattatgccgttaaggtgcctgacggtctcgatcctgcggtcgcc
agcagcattacctgcgccggtgtcactacctacaaggcggtgaaaatctccggtatttct
cccggaaaatggctggttgtctatggccttggcggtctgggcaatctggcgctgcagtac
gcaaaaaatgtgtttaatgccaaagtcatcgccgttgacgtcagcgatgcccagctgaaa
tttgccgaagagatgggggccgatatggtgatcaactcgcgtaatgaagacgcggcacgg
ctgatccagcaacgcacggggggcgcacatgctgccgtggtaacagccgttgccaaagcg
gcgtttaattctgcggtggatgcgatgcgcgcaggtggccgtattgtggcagtgggcctg
ccgccggaatcgatgagcctgaatatcccgcgtctggtgctggacggcatccaggtcgtc
ggctcgctggtcggcacgcgtgaagatttagctgaagctttccagttcgcggctgaaggc
aaagttgtacccaaagtcactcgccgcccgctgcaggacatcaacgcgatcttccatgaa
atggaaagcggaaaaatcgttggccgcatggtgattgattttaacagtacccattaa

DBGET integrated database retrieval system