KEGG   Erwinia pyrifoliae Ep1/96: EpC_25580Help
Entry
EpC_25580         CDS       T01000                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:epy01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2832419..2833012
Genome map
AA seq 197 aa AA seqDB search
MTLRAAAADTLLVLGDSLSAGYRMSASAAWPALLNEKWQKSPAIINGSISGDTTAQGLAR
LPALLKQHQPRWVLIELGGNDGLRGFPPQQVEQDLNQAIAQIQAAKAQPLLMQVRLPANY
GKRYTDSFAAIYPRLASQHAIPLVPFFMEQVYLKPEWMQDDGIHPNPVAQPFIADLMAKQ
LAFLVKHQASDSVGNDG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcgtgcggcggcggcagatacgctgctggtgctgggcgacagcctgagcgcc
ggttaccgcatgtccgccagtgccgcatggcccgcgttactcaatgagaaatggcaaaaa
tcccctgctatcattaacggtagcataagcggcgatactacggcacagggactggcccga
cttccggcgctgctgaaacaacatcagccgcgctgggtactgattgagctggggggtaac
gatgggttgcgtggtttccctccgcagcaggtcgagcaggatttgaatcaggccattgct
caaatccaggcggcaaaggcgcagccgctgctgatgcaggtgcggctaccggccaactac
ggcaagcgctacaccgattcatttgccgccatctatcccagactggccagtcagcatgcg
atcccgctggtgccgttctttatggaacaggtctacctgaagccggaatggatgcaggat
gacggcattcaccctaatccggtggcccagccttttattgccgatttgatggcaaaacag
ctggctttcttagttaagcatcaggcatcggatagcgtggggaatgatgggtaa

DBGET integrated database retrieval system