KEGG   Erwinia pyrifoliae Ep1/96: EpC_27290Help
Entry
EpC_27290         CDS       T01000                                 

Definition
methionine salvage pathway protein E-2/E-2
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EpC_27290
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     EpC_27290
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     EpC_27290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2998392..2998934)
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTDSEATTPVWYSMDAAEMAEKLRSKGVRFERWHADRDLGDNPDSETVIDAYQH
AIDRLVAEKGYQSWDVISMRADNPQKEALRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
HIFQVLCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIAKFTGDPIADGYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgactatttttaccgatagtgaagcgaccaccccggtatggtacagcatg
gatgcggctgaaatggctgaaaagctgcgcagcaaaggggtgcgctttgaacgctggcat
gccgaccgcgacctgggggataaccctgactcagagacggtaatcgatgcctatcagcat
gctattgaccggttggtggcggagaaaggctaccaaagctgggacgtgatcagcatgcgt
gccgacaacccgcagaaggaggcgttgcgcagcaagtttctctctgaacatactcacgga
gaagatgaagtgcgcttctttgtcgaaggggcggggctgttctgcctgcatcttgacggg
catattttccaggtgctgtgtgaaaaaaatgacctgatctcggttccggcagggactcca
cactggtttgatatgggatcctcaccgcactttactgccatccgcatcttcgacaatcag
gaaggctggatcgctaaatttaccggcgatccgattgcggacggctatccgcgcctgcct
taa

DBGET integrated database retrieval system