KEGG   Erwinia pyrifoliae Ep1/96: EpC_28640Help
Entry
EpC_28640         CDS       T01000                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:epy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3146272..3148119)
Genome map
AA seq 615 aa AA seqDB search
MTLAEALQLAQHQRLLRPLDVQFACMVATEQQPALMLAAALVSRDAGEGHVCLPLAQLRP
ASFFAGRHPELAQALWQAAGAPEDWQALLLAQSAVSDGQQATPLVVYQQRLYLHRMWQSE
GEIAQFIQRQNYPQDLEEKRVRDTLERYFGQQPDDWQKIAAAVALTRQVSVISGGPGTGK
TTTVAKLLASLIELSPTPPRIELAAPTGKAAARLTESLGKTLLQLQLADRILRSFPLEAT
TLHRLLGALPGSQRMRYHAGNPLHLDVLVVDEASMVDLPMLANLIAALPAHARVIFLGDR
DQLASVEAGAVLGDICRCAEEGYSPQRAAELTRLTGCEVAGREDASASAVRDTICLLRKS
YRFTQSSGIGQLALAVNAGEVKRAEQLFSKGLSDIRHHTLSSSEDYQQLLDDCVAGYREY
LKLLKEGATPGEVLAAFGRFQLLCAVREGPFGVAGLNDRIEQTLRLTGLIRRNTALNGKW
YAGRPVMIARNDRALGLFNGDIGIAMPDEKQQLKVYFPLPDGTLKAVQPSRLPPHDTAYA
MTVHKSQGSEFEHTLLVLPNQMMPVLTRELVYTAMTRARQQLTLYADFSVFNSAVKIRTQ
RRSGLVDRLNNRAAF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcagaagccttacagctggcacagcaccagcgcttactacgtcctctggac
gtgcagtttgcctgcatggtggcaactgaacagcagcccgcgctgatgctggcggcagcg
ctggtcagccgcgacgccggggaaggtcatgtttgtctgccgttggcacagctgcggcct
gcctctttttttgccgggcgccatccggagctggcacaggcactgtggcaggctgcgggc
gcgccggaggactggcaggcgctgctgctggcacaaagcgcggtcagcgacggccagcag
gccacgccgctggtggtgtatcaacagcggctttatctgcatcgtatgtggcaaagcgag
ggggaaattgcgcagtttattcagcgtcagaattatcctcaggatctggaagaaaagcgg
gtgcgtgatacgctggagcgttattttggccagcagcccgatgactggcaaaagatcgcc
gcagcggtagcgctgacgcgccaggtgtcggtgatctccggcgggcctggaaccggcaaa
accaccaccgtggccaagctgcttgccagcctgattgaactatcgcccacgccaccgcgt
atcgaactggcggcaccgaccggcaaggcggcggcgcggctgacggaatcgctcggtaaa
acgctgctacagctgcagctggccgatcgcatcctgagaagtttcccattggaggcgacg
acgctgcatcgcctgctgggggcgctgccgggcagtcagcgcatgcgctatcatgccgga
aatccactgcatcttgacgtactggtcgtcgatgaagcctcaatggtggatctcccgatg
ctggctaacctgattgccgctttgcccgctcatgcgcgggttatctttctcggtgaccgc
gatcagctggcttcagtcgaagccggagcggtgctgggtgatatttgccgttgtgcggaa
gagggctacagcccgcagcgtgccgcagagctgacgcgtcttaccggctgcgaggtggcg
gggcgcgaagatgccagcgcctctgcggtgcgcgatacgatctgcctgctgcgtaaaagc
tatcgttttacgcaatcatccggcatcggccagctggcgctggcggttaatgcgggtgag
gtaaaaagggcagagcagttattcagcaagggtttaagcgatatccgccaccatacgcta
agcagcagcgaggactatcagcagctgctggacgactgtgttgcagggtaccgtgaatac
ctgaaattgctgaaggaaggagccacgccaggcgaagtcctggccgcatttggccgcttc
cagctgctgtgcgctgtgcgcgaaggaccgtttggtgttgcagggctgaatgaccgtatt
gaacagacgctgcgcctgacggggcttatccgccgcaataccgcacttaacggcaaatgg
tacgctggtcgcccggtgatgattgcgcgcaatgaccgtgcgctcggcctgtttaacggt
gatatcggcatcgcgatgccggatgaaaaacagcagctgaaagtgtattttccgttaccg
gatggcactctcaaggcggtgcagcccagccgcctgccgccgcatgatacggcctatgcc
atgacggtgcacaagtcgcagggatccgagtttgagcacacgctgctggttttacctaac
cagatgatgccggtactgacccgtgaactggtttataccgccatgacccgcgccagacag
cagttaaccctttatgccgacttttcggtgttcaacagtgcggtgaagatacgcacgcag
cggcgtagtgggctggtggatcggttgaataacagggcagctttttag

DBGET integrated database retrieval system