KEGG   Erwinia pyrifoliae Ep1/96: EpC_29290Help
Entry
EpC_29290         CDS       T01000                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3229543..3230247)
Genome map
AA seq 234 aa AA seqDB search
MKKHYLLLSVILAAASGLANADDAAIQQSLSKLGLQQTEIQPAPLPGFKTVLSESGVLYI
TDDGKHFIQGPLYDVSGGRPVNVTNKLLEKKVDALSKEMIVYKAAKEQHVVTVFTDITCG
YCHKLHQQMADYNALGITVRYLAFPREGMEGPVAKKMKSIWCAADRNKALDAAMKGEDVK
ATDCKIDLAQQFKLGAQYGIQGTPAMLLQDGTLVPGYQGAQELKKFLDGQKNGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcattacctgttactttcggtgatattagccgcagccagtggtctggcgaac
gctgatgatgcagcgattcagcagtcgttgagcaagctgggcttacagcagaccgagatc
cagcctgcgccgctgccgggttttaaaaccgtgctgagtgaaagcggtgtgctgtacatc
accgatgacggcaagcatttcatccaggggccgctttatgatgtcagcggcggccgcccg
gttaacgtcaccaataagctgctggaaaagaaagtggacgcgctgagtaaagagatgatc
gtttacaaagcggcgaaagagcagcatgtggtgacggtgtttaccgatatcacctgtggt
tactgccataagctgcatcagcagatggcggactataacgcgctggggatcaccgtacgc
tatctggccttcccgcgtgaagggatggaaggcccggtagcgaaaaaaatgaaatccatc
tggtgtgccgccgatcgtaacaaggcgcttgatgcggcaatgaaaggtgaagacgtgaag
gcgaccgactgcaagattgaccttgcacagcaattcaaactgggcgcccagtacggtatt
cagggtactccggccatgctgttgcaggacggcacgctggtccctggctaccagggagcg
caggaactgaagaaattccttgatggccagaaaaatggtgactga

DBGET integrated database retrieval system