KEGG   Erwinia pyrifoliae Ep1/96: EpC_32730Help
Entry
EpC_32730         CDS       T01000                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00010  Glycolysis / Gluconeogenesis
epy00620  Pyruvate metabolism
epy00640  Propanoate metabolism
epy00680  Methane metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_32730 (acs)
   00620 Pyruvate metabolism
    EpC_32730 (acs)
   00640 Propanoate metabolism
    EpC_32730 (acs)
  Energy metabolism
   00680 Methane metabolism
    EpC_32730 (acs)
Enzymes [BR:epy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EpC_32730 (acs)
Lipid biosynthesis proteins [BR:epy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EpC_32730 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAX57052
Position
3571686..3573641
Genome map
AA seq 651 aa AA seqDB search
MSHAHIYPIPANIAQNTLINPRQYHSMYQQSVQDPEAFWGEQGKIVDWIKPYATVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLAARGDHPAMIWEGDDASESKTITYRELHHDVCRF
SNALKALGIHKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSHA
RLVITADEGVRAGRTIPLKKNVDDALNNPGVTSVDNVIVLRRTGKDISWHHGRDLWWHEQ
VNSASEQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPEDI
YWCTADVGWITGHSYLLYGPLACGATTLMFEGVPNWPKPSRMAEVVDKHRVTILYTAPTA
VRALMAEGDKAIAGTHRSSLRILGSVGEPINPEAWEWFHQKIGNGHCPISDTWWQTETGG
FMIAPLPGATALKPGSATHPFFGVQPALVDNEGHLQEGASEGNLVIVDSWPGQARTLFGD
HQRFEQTYFSTFKNRYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHALKGQAIYAYITLNRGEEPSPQLYSEVRAWVRKEIGPIATPDVLHWTE
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPGVVDKLLEEKLSINMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccatgcacatatttaccctatcccggccaacattgcgcaaaatacgctgattaat
ccccggcaatatcattcaatgtatcaacaatcggtacaggatcccgaggcattttggggg
gagcaaggcaagattgttgactggataaaaccttacgctacggtaaagaacacctccttt
gcccctggcaacatctcaattcgctggtatgaggacggcacgctaaacctggccgctaac
tgcctcgaccggcatctggcggcgcgcggcgaccacccggcgatgatctgggaaggggat
gacgccagcgaaagcaaaaccatcacctaccgcgaactgcatcacgacgtatgtcgcttt
tccaacgccctgaaagcgctgggaatccataaaggcgatgtggtagcgatctatatgcca
atggtgccagaagccgccgtggccatgctggcctgcgcgcgcatcggtgccgtgcattcg
gttatcttcggcggtttttcaccggaagccgttgccgggcgaattatcgacagccacgcc
cgcctggtgatcaccgccgacgaaggcgtgcgtgccggacgcaccattccgctgaagaaa
aacgtcgatgatgcactgaataatcctggcgtgaccagcgtcgacaacgtcattgtcctc
aggcgcaccggcaaagatattagctggcaccacggccgtgatctttggtggcatgagcag
gtgaacagtgccagcgagcagcatcagcctgaagagatgaacgcggaagacccattattt
atcctgtatacctccggttctaccggcaaaccaaagggggtgctgcataccaccggcggt
tatctggtttatgcagcgaccaccttcaaatacgtcttcgattatcacccggaggatatc
tactggtgtaccgccgatgtcggttggattaccggacacagttacctgctgtatggcccg
ctggcctgtggtgccaccactctgatgtttgaaggggtgccaaactggccaaaacccagt
cgtatggccgaagtggttgataaacaccgggtgaccatcctgtataccgcacccacggcg
gtgcgtgcgttgatggccgaaggggataaagccattgccggcacccatcgttccagcctg
cgcatccttggctcggtaggcgagccgattaacccggaggcctgggagtggttccatcaa
aaaatcggtaatggccattgccccatttcagatacctggtggcagacggaaacgggcgga
tttatgatcgctccgctccccggagccaccgcgctgaaacccggatcggctacccatccc
ttttttggcgtacagcccgcgctggtcgataacgaaggtcatctgcaggaaggtgccagc
gaaggcaatttggttatcgttgattcctggcctggccaggcacgcacgctatttggcgat
catcagcgctttgagcaaacctacttctccaccttcaaaaaccgctatttcagcggcgac
ggcgctcgccgtgatgaagacggctattactggataaccggacgcgtcgacgacgtactg
aatgtttccggtcatcgtttggggacggcggagattgagtccgcgctggtctcgcatccg
aaaattgcggaagcagcggtagtgggtattccgcacgctttgaaaggccaggcgatctac
gcctacattacgctgaaccgtggtgaagagccttcgccgcagctgtacagcgaagtgcgt
gcctgggtgcgtaaagagattggccccattgccacaccggacgtgctgcactggaccgaa
tcattaccgaagacccgctcggggaaaattatgcgccgcattttgcgcaaaatcgccacc
ggcgataccagcaatctcggtgatacttccacgctggccgatcccggcgtggtagacaaa
ttactcgaagaaaaactgtcgattaacatgccataa

DBGET integrated database retrieval system