KEGG   Erwinia pyrifoliae Ep1/96: EpC_35980Help
Entry
EpC_35980         CDS       T01000                                 

Gene name
celY
Definition
Minor endoglucanase Y (Endo-1,4-beta-glucanase Y) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:epy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3915472..3916470)
Genome map
AA seq 332 aa AA seqDB search
MAIVRAGFMLLVLILGLSQATAADGWSSFKTRFMTSDGRIQDTGNQNVSHTEGQGYAMLM
AVYYNDRSGFDKLWHWTQNNLSNPKNGLFYWKYNPAVRDPISDKNNAADGDVLIAWALLK
AGEKWQVSAWLQQSDLIQRAIVAHNVIAFGGRTVMLPGAQGFNKTSYVVLNPSYFVFPAW
RDFARRSHLKVWEQLIGDGQALLKEMRFGDSALPLDWVAMNADGSLAPATAWPPRFSYDA
IRIPLYLHWYDATSSGLVPFQRFWAGFQRLQTPAWVDVLSNDKAPYNMAGGLLAVRDLTL
GDTGYLNGSPGASEDYYSSSLHLLTWLAFKDR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtcagggctggcttcatgctgttggtgcttatactgggcctgtctcaggcg
actgccgcagatggctggagcagctttaaaacgcgctttatgaccagcgatggtcgtatt
caggatacgggcaatcagaacgtcagccacaccgaaggccagggatatgccatgctgatg
gcggtttactacaacgaccgcagcggctttgacaagctgtggcactggacacagaacaat
ctaagtaacccgaagaacggcctgttttactggaaatacaaccctgcagtccgcgacccg
attagcgataaaaataacgccgccgacggggatgtactgattgcctgggcgctgctgaaa
gcgggggaaaagtggcaggtttccgcctggttgcagcagtcagacctgatccagagggct
attgtggcgcataacgtgattgcctttggcggtcgcaccgtgatgcttcccggcgcgcag
ggctttaataaaaccagctacgtggtgctgaacccgtcctattttgtcttcccggcgtgg
cgtgattttgcccggcgcagtcatttaaaggtgtgggagcagctgatcggcgacgggcag
gcgttgctcaaggagatgcgttttggcgatagcgctttgccgctggactgggtggcaatg
aacgctgacggctcgctggctccggctaccgcctggccaccgcgatttagttatgatgcc
atccgtattccgttgtacctgcactggtacgacgccacgtcttccgggctggtgcctttc
cagcgtttctgggccggtttccagcgcctgcaaaccccggcatgggtagacgtgctaagc
aacgataaagccccctacaatatggcaggcggcctgctggcggtgcgtgatttaaccctg
ggtgataccgggtatctcaatggatcaccgggtgccagtgaagactattactcatcaagc
ctgcacctgttaacctggctggcgtttaaagaccgctaa

DBGET integrated database retrieval system