KEGG   Equus przewalskii (Przewalski's horse): 103541768Help
Entry
103541768         CDS       T04644                                 

Definition
(RefSeq) insulin receptor-like
  KO
K04527  
insulin receptor [EC:2.7.10.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adherens junction
Insulin signaling pathway
Ovarian steroidogenesis
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:epz00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    103541768
   04015 Rap1 signaling pathway
    103541768
   04010 MAPK signaling pathway
    103541768
   04066 HIF-1 signaling pathway
    103541768
   04068 FoxO signaling pathway
    103541768
   04072 Phospholipase D signaling pathway
    103541768
   04022 cGMP - PKG signaling pathway
    103541768
   04151 PI3K-Akt signaling pathway
    103541768
   04152 AMPK signaling pathway
    103541768
   04150 mTOR signaling pathway
    103541768
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    103541768
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103541768
   04923 Regulation of lipolysis in adipocyte
    103541768
   04913 Ovarian Steroidogenesis
    103541768
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103541768
  Aging
   04211 Longevity regulating pathway - mammal
    103541768
   04213 Longevity regulating pathway - multiple species
    103541768
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103541768
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103541768
   04931 Insulin resistance
    103541768
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103541768
Protein kinases [BR:epz01001]
 Tyrosine protein kinases
  InsR family [OT]
   103541768
Enzyme-linked receptors [BR:epz01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   103541768
Cytokine receptors [BR:epz04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   103541768
CD molecules [BR:epz04090]
 Proteins
  103541768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 314 aa AA seqDB search
IEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGR
PPPTLQEMVQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETD
YYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKF
VMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEE
NKAPESEELEMEFEDMENVPLDRSSHSQREEAGGRDAGSSLGLKRNYEEHIPYTHMNGGK
KNGRILTLPRSNPS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atcgagtttctcaacgaggcctcagtcatgaagggcttcacctgccatcacgtggtccgc
ctcctgggggtggtatcgaaaggccagccaacgctggtggtgatggagttgatggctcat
ggagacctgaagagctacctccgttccctgcggccggaggctgagaataaccctggccgc
cctccccctaccctgcaagagatggttcagatggcggcggagatcgccgacgggatggcg
tacctgaacgccaagaagtttgtgcaccgggacctggcagctcgaaactgcatggtcgcc
cacgattttaccgtcaaaatcggagactttggaatgaccagagacatctacgaaacggat
tactaccggaaaggaggcaaggggctgctccccgtgaggtggatggctcctgaatccctg
aaggacggggtctttactacttcttctgacatgtggtcctttggcgtggtcctttgggaa
atcaccagcttggcagaacagccttaccaaggcctgtctaatgagcaggtgttgaaattt
gtcatggatggagggtatctggatcaacccgacaattgtcccgagagagtcaccgacctg
atgcgtatgtgctggcagttcaaccccaagatgcggccgaccttcctggagattgtcgac
ctgctcaaggatgacctgcaccccagctttccagaagtttccttcttccacagcgaggag
aacaaggcccccgagagcgaggagctggagatggagtttgaggacatggagaacgtcccc
ctggatcggtcctcacattcccagagggaggaggccgggggccgggatgcagggtcctcg
ctgggtctaaagcggaactatgaggaacacatcccgtacactcacatgaacgggggcaag
aaaaatgggcggattctgactctgccgaggtcaaatccttcctaa

DBGET integrated database retrieval system