KEGG   Equus przewalskii (Przewalski's horse): 103541768Help
Entry
103541768         CDS       T04644                                 

Definition
(RefSeq) insulin receptor-like
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04072  Phospholipase D signaling pathway
epz04150  mTOR signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04152  AMPK signaling pathway
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz04520  Adherens junction
epz04910  Insulin signaling pathway
epz04913  Ovarian steroidogenesis
epz04923  Regulation of lipolysis in adipocytes
epz04930  Type II diabetes mellitus
epz04931  Insulin resistance
epz04932  Non-alcoholic fatty liver disease (NAFLD)
epz04960  Aldosterone-regulated sodium reabsorption
Module
epz_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:epz00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    103541768
   04015 Rap1 signaling pathway
    103541768
   04010 MAPK signaling pathway
    103541768
   04066 HIF-1 signaling pathway
    103541768
   04068 FoxO signaling pathway
    103541768
   04072 Phospholipase D signaling pathway
    103541768
   04022 cGMP - PKG signaling pathway
    103541768
   04151 PI3K-Akt signaling pathway
    103541768
   04152 AMPK signaling pathway
    103541768
   04150 mTOR signaling pathway
    103541768
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    103541768
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103541768
   04923 Regulation of lipolysis in adipocyte
    103541768
   04913 Ovarian Steroidogenesis
    103541768
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103541768
  Aging
   04211 Longevity regulating pathway - mammal
    103541768
   04213 Longevity regulating pathway - multiple species
    103541768
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103541768
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103541768
   04931 Insulin resistance
    103541768
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103541768
Protein kinases [BR:epz01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103541768
CD molecules [BR:epz04090]
 Proteins
  103541768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like B2 APH
Motif
Other DBs
NCBI-GeneID: 103541768
NCBI-ProteinID: XP_008506859
Position
Un
AA seq 314 aa AA seqDB search
IEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGR
PPPTLQEMVQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETD
YYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKF
VMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEE
NKAPESEELEMEFEDMENVPLDRSSHSQREEAGGRDAGSSLGLKRNYEEHIPYTHMNGGK
KNGRILTLPRSNPS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atcgagtttctcaacgaggcctcagtcatgaagggcttcacctgccatcacgtggtccgc
ctcctgggggtggtatcgaaaggccagccaacgctggtggtgatggagttgatggctcat
ggagacctgaagagctacctccgttccctgcggccggaggctgagaataaccctggccgc
cctccccctaccctgcaagagatggttcagatggcggcggagatcgccgacgggatggcg
tacctgaacgccaagaagtttgtgcaccgggacctggcagctcgaaactgcatggtcgcc
cacgattttaccgtcaaaatcggagactttggaatgaccagagacatctacgaaacggat
tactaccggaaaggaggcaaggggctgctccccgtgaggtggatggctcctgaatccctg
aaggacggggtctttactacttcttctgacatgtggtcctttggcgtggtcctttgggaa
atcaccagcttggcagaacagccttaccaaggcctgtctaatgagcaggtgttgaaattt
gtcatggatggagggtatctggatcaacccgacaattgtcccgagagagtcaccgacctg
atgcgtatgtgctggcagttcaaccccaagatgcggccgaccttcctggagattgtcgac
ctgctcaaggatgacctgcaccccagctttccagaagtttccttcttccacagcgaggag
aacaaggcccccgagagcgaggagctggagatggagtttgaggacatggagaacgtcccc
ctggatcggtcctcacattcccagagggaggaggccgggggccgggatgcagggtcctcg
ctgggtctaaagcggaactatgaggaacacatcccgtacactcacatgaacgggggcaag
aaaaatgggcggattctgactctgccgaggtcaaatccttcctaa

DBGET integrated database retrieval system