KEGG   Equus przewalskii (Przewalski's horse): 103550624Help
Entry
103550624         CDS       T04644                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:epz00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    103550624 (ABHD6)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103550624 (ABHD6)
Peptidases [BR:epz01002]
 Serine Peptidases
  Family S33
   103550624 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 398 aa AA seqDB search
MGRGPAPPFLLRPPLRHQPLRPPFRCLDRCDPLVPLLRGSGQPAARSPGTSPCRCQPALK
SRMDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDY
QFCYSFRGRPGQRPSILMLHGFSAHKDMWLSVVKFLPKNLHLICVDMPGHEGTTRSSLDD
LSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQC
SSDNQFIQRLRELQKSAAMEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQLLQGLVDVRIP
HNNFYRKLFLEITSEKSRYCLHQNMGKIKVPTQIIWGKQDQVLDVSGADVLAKSIANCQV
ELLENCGHSVVMERPRKTAKLIVDFYASLYNTDNKKLD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggggacctgcacctccctttctactccgtcccccgctccggcatcagcccctg
cgccctcccttccggtgcctggataggtgtgatcccctggtccccctgcttcgcgggtcc
gggcagcctgccgcccgaagcccggggacaagcccctgcaggtgtcagccagccctaaag
agcaggatggatcttgacgtggttaatatgtttgtgatcgcgggcgggaccttggccatc
ccaatcctggcgtttgtagcctcgtttctcctgtggccttcagcactgatcagaatctac
tattggtactggcgaaggacattgggcatgcaggtccgctatgttcaccacgaagactat
caattctgttactccttccgcggcagacccgggcagaggccttccatcctcatgctccac
ggattctctgcgcacaaggatatgtggctcagcgtggtcaagttccttccaaagaatctg
cacttgatctgtgtggacatgccaggacatgagggcaccacccgttcctccctggatgac
ctgtccatagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaac
aaaaaacctttccacctggtaggcacctccatgggtggccatgtggctggggtgtatgct
gcttactacccatcggatgtctgcagcctgtctctcgtttgccccgctggcctgcagtgc
tcaagtgataatcaatttatacaacggctcagagaactgcagaaatcggctgctatggag
aagattcccttgatcccatccaccccagaagaaatgagtgaaatgctccagctctgctcc
tatgtccgcttcaaggtgccacagcagcttctgcagggccttgtcgacgtccgcatccct
cataacaacttctaccgaaagttgtttttggaaatcaccagtgagaagtcaagatactgc
ctccatcagaacatgggcaagatcaaggtcccaacgcagatcatctgggggaaacaagac
caggtgcttgatgtgtctggggcagatgtgttggccaagtcaatcgccaactgccaggtg
gaacttctggaaaactgtgggcactcagtggtgatggagagacccaggaagacagccaag
ctcatcgttgacttttatgcctctctgtacaacacagacaacaagaagctagactga

DBGET integrated database retrieval system