KEGG   Eubacterium rectale M104/1: ERE_01850Help
Entry
ERE_01850         CDS       T02588                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
era  Eubacterium rectale M104/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:era00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162866..164824
Genome map
AA seq 652 aa AA seqDB search
MCNFTAMDCYLFGQATHYDIYKKMGAHLAERKGKKGVCFDVWAPHAREVYVFGEFNDWNE
TSHEMKRVEPETMGVYELFVPGAQKGQMYKFIIVTEQGDKLYKADPYANYAELRPGTASI
ITDIEHFTWTDKEWMDKRAAKSDADVYSSPMAIYECHPGSWMRHPGRDDEGFYTYRELAK
SLISYVKTMGYTHIELMGISEYPFDGSWGYQVTGYYAPTSRYGEPEDFAYFVDQCHKNNI
GVILDWVPAHFPKDAHGLANFDGTATYEYADPRKGEHPDWGTKIFDYGKNEVKNFLIGSA
LMWIENYHVDGLRVDAVASMLYLDYGKNDGQWVPNKFGGNKNLEAVEFFKHINTLILGRN
HGTVMIAEESTAWPKVTGKVEEDGLNFSYKWNMGWMHDFLDYMKLDPYFRKNNHNKMTFA
MSYNESEKYILVLSHDEVVHLKCSMLNKMPGLEGDKFKNLMAGYAFMMGHCGKKLLFMGQ
EFAQKQEWSEERELDWYLLENPEHKKIQNWVKELLHLYRRNRCLYELDSSWEGFEWINAN
DADRSIFSFIRKSKDGKNNMLFVINFTPVERPDYRVGVPKRKTYQLVLDSEDPKFTGKTV
QEPVKKAAKGRGKAAKQSYKKLDYKAVKSECDGRPFSFAYPLAPYGVAVFKY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaattttacagcaatggattgttacctgtttggtcaggcaacacactatgatatc
tacaagaagatgggtgctcacttagctgagcgtaaaggaaaaaaaggagtgtgctttgac
gtctgggcgccacatgcgagggaagtatacgtgtttggtgagtttaacgactggaatgag
accagtcatgagatgaagcgtgtagagccggaaaccatgggagtgtatgagctttttgta
ccgggagcgcaaaagggtcagatgtataagtttattatagtcactgaacagggtgataag
ctgtacaaggcggatccatacgcaaactacgcagagcttcgtccgggaacagcgtcaatc
atcacagatatcgagcacttcacatggactgacaaagagtggatggataagagagcagca
aagtcagatgctgatgtatattcttcacctatggctatatatgagtgccatcctggctca
tggatgagacatccgggcagggatgatgagggtttttatacatacagggagcttgcaaaa
tcactcatatcatatgtaaaaactatgggatatacacatattgagcttatgggtatttca
gagtatccgtttgatggctcatggggatatcaggtgacaggctactatgcacctacatcg
aggtatggagagcctgaggattttgcatactttgttgatcagtgccataaaaataatatc
ggagtaatcctcgactgggtacctgcacatttcccaaaggatgcgcatggacttgccaat
ttcgacggaacagccacatatgagtatgcagacccaagaaagggagagcatcccgactgg
ggcacaaagatatttgactacggcaagaatgaagtaaagaacttccttatcggaagtgca
cttatgtggatagaaaattaccacgtagacggactccgtgtggatgcagttgcgtcaatg
ctttatcttgactatggaaagaacgacggacagtgggtgccaaacaagtttggaggaaat
aagaacctcgaggcagtagagtttttcaagcatatcaatacactcatacttggaagaaat
cacggaactgtaatgatagccgaagagtctaccgcatggccaaaggtaacaggcaaggta
gaggaagacggactgaacttcagctacaaatggaacatgggatggatgcatgacttcctt
gattatatgaagctggatccatatttccgtaaaaataaccacaacaagatgacatttgcg
atgagctataatgagagtgagaaatatattctggtactgtcacatgatgaggtggtacat
ctgaagtgttctatgctcaacaaaatgccgggcttagaaggggataaattcaagaacctc
atggcaggatatgcatttatgatgggacactgtggaaagaagcttcttttcatgggacag
gagtttgcacagaagcaggagtggagtgaggaaagagaactcgactggtatctgcttgag
aatccggagcataaaaagatccagaactgggtaaaggagctgcttcacctctataggaga
aaccgctgtctgtatgagctggattcaagctgggaaggctttgaatggataaatgcaaac
gatgcagacagaagcatcttcagctttatcagaaagagcaaggatggcaagaataatatg
ctctttgtcatcaatttcacaccggtagagagacctgattacagagtcggagtgccaaag
cgcaagacatatcagcttgttttagatagtgaggatcctaagtttacaggcaaaacggta
caagagcctgtaaagaaggctgcaaagggcagaggcaaggcagcaaaacagtcatataag
aagctggactataaggcagtcaaatcagagtgtgacggcagaccattttcatttgcttat
ccacttgcgccttacggagttgctgtatttaaatactaa

DBGET integrated database retrieval system