KEGG   Eubacterium rectale M104/1: ERE_01850Help
Entry
ERE_01850         CDS       T02588                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
era  Eubacterium rectale M104/1
Pathway
era00500  Starch and sucrose metabolism
era01100  Metabolic pathways
era01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ERE_01850
Enzymes [BR:era01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ERE_01850
Exosome [BR:era04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERE_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CBK92321
UniProt: D4JMW7
Position
162866..164824
Genome map
AA seq 652 aa AA seqDB search
MCNFTAMDCYLFGQATHYDIYKKMGAHLAERKGKKGVCFDVWAPHAREVYVFGEFNDWNE
TSHEMKRVEPETMGVYELFVPGAQKGQMYKFIIVTEQGDKLYKADPYANYAELRPGTASI
ITDIEHFTWTDKEWMDKRAAKSDADVYSSPMAIYECHPGSWMRHPGRDDEGFYTYRELAK
SLISYVKTMGYTHIELMGISEYPFDGSWGYQVTGYYAPTSRYGEPEDFAYFVDQCHKNNI
GVILDWVPAHFPKDAHGLANFDGTATYEYADPRKGEHPDWGTKIFDYGKNEVKNFLIGSA
LMWIENYHVDGLRVDAVASMLYLDYGKNDGQWVPNKFGGNKNLEAVEFFKHINTLILGRN
HGTVMIAEESTAWPKVTGKVEEDGLNFSYKWNMGWMHDFLDYMKLDPYFRKNNHNKMTFA
MSYNESEKYILVLSHDEVVHLKCSMLNKMPGLEGDKFKNLMAGYAFMMGHCGKKLLFMGQ
EFAQKQEWSEERELDWYLLENPEHKKIQNWVKELLHLYRRNRCLYELDSSWEGFEWINAN
DADRSIFSFIRKSKDGKNNMLFVINFTPVERPDYRVGVPKRKTYQLVLDSEDPKFTGKTV
QEPVKKAAKGRGKAAKQSYKKLDYKAVKSECDGRPFSFAYPLAPYGVAVFKY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaattttacagcaatggattgttacctgtttggtcaggcaacacactatgatatc
tacaagaagatgggtgctcacttagctgagcgtaaaggaaaaaaaggagtgtgctttgac
gtctgggcgccacatgcgagggaagtatacgtgtttggtgagtttaacgactggaatgag
accagtcatgagatgaagcgtgtagagccggaaaccatgggagtgtatgagctttttgta
ccgggagcgcaaaagggtcagatgtataagtttattatagtcactgaacagggtgataag
ctgtacaaggcggatccatacgcaaactacgcagagcttcgtccgggaacagcgtcaatc
atcacagatatcgagcacttcacatggactgacaaagagtggatggataagagagcagca
aagtcagatgctgatgtatattcttcacctatggctatatatgagtgccatcctggctca
tggatgagacatccgggcagggatgatgagggtttttatacatacagggagcttgcaaaa
tcactcatatcatatgtaaaaactatgggatatacacatattgagcttatgggtatttca
gagtatccgtttgatggctcatggggatatcaggtgacaggctactatgcacctacatcg
aggtatggagagcctgaggattttgcatactttgttgatcagtgccataaaaataatatc
ggagtaatcctcgactgggtacctgcacatttcccaaaggatgcgcatggacttgccaat
ttcgacggaacagccacatatgagtatgcagacccaagaaagggagagcatcccgactgg
ggcacaaagatatttgactacggcaagaatgaagtaaagaacttccttatcggaagtgca
cttatgtggatagaaaattaccacgtagacggactccgtgtggatgcagttgcgtcaatg
ctttatcttgactatggaaagaacgacggacagtgggtgccaaacaagtttggaggaaat
aagaacctcgaggcagtagagtttttcaagcatatcaatacactcatacttggaagaaat
cacggaactgtaatgatagccgaagagtctaccgcatggccaaaggtaacaggcaaggta
gaggaagacggactgaacttcagctacaaatggaacatgggatggatgcatgacttcctt
gattatatgaagctggatccatatttccgtaaaaataaccacaacaagatgacatttgcg
atgagctataatgagagtgagaaatatattctggtactgtcacatgatgaggtggtacat
ctgaagtgttctatgctcaacaaaatgccgggcttagaaggggataaattcaagaacctc
atggcaggatatgcatttatgatgggacactgtggaaagaagcttcttttcatgggacag
gagtttgcacagaagcaggagtggagtgaggaaagagaactcgactggtatctgcttgag
aatccggagcataaaaagatccagaactgggtaaaggagctgcttcacctctataggaga
aaccgctgtctgtatgagctggattcaagctgggaaggctttgaatggataaatgcaaac
gatgcagacagaagcatcttcagctttatcagaaagagcaaggatggcaagaataatatg
ctctttgtcatcaatttcacaccggtagagagacctgattacagagtcggagtgccaaag
cgcaagacatatcagcttgttttagatagtgaggatcctaagtttacaggcaaaacggta
caagagcctgtaaagaaggctgcaaagggcagaggcaaggcagcaaaacagtcatataag
aagctggactataaggcagtcaaatcagagtgtgacggcagaccattttcatttgcttat
ccacttgcgccttacggagttgctgtatttaaatactaa

DBGET integrated database retrieval system