KEGG   Eubacterium rectale M104/1: ERE_18030Help
Entry
ERE_18030         CDS       T02588                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
era  Eubacterium rectale M104/1
Pathway
era00220  Arginine biosynthesis
era00250  Alanine, aspartate and glutamate metabolism
era00290  Valine, leucine and isoleucine biosynthesis
era01100  Metabolic pathways
era01110  Biosynthesis of secondary metabolites
era01130  Biosynthesis of antibiotics
era01210  2-Oxocarboxylic acid metabolism
era01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ERE_18030
   00290 Valine, leucine and isoleucine biosynthesis
    ERE_18030
   00220 Arginine biosynthesis
    ERE_18030
Enzymes [BR:era01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ERE_18030
    2.6.1.66  valine---pyruvate transaminase
     ERE_18030
Amino acid related enzymes [BR:era01007]
 Aminotransferase (transaminase)
  Class I
   ERE_18030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Arc
Motif
Other DBs
NCBI-ProteinID: CBK93735
UniProt: D4JJD8
Position
complement(1843673..1844890)
Genome map
AA seq 405 aa AA seqDB search
MREFGKSRKLDNVLYDVRGPVVDEAARMEENGTNVLKLNIGNPAPFGFRTPDEVIYDMSR
QLTDCEGYSNSKGLFSARKAIMQYAQLKKLPNVTVEDIYTGNGVSELINLSMSALLDNGD
EVLVPAPDYPLWTACVTLAGGTAVHYICDEQSEWYPDIEDIKKKITDKTKAIVIINPNNP
TGALYPREVLQQIVDVAREHELMIFSDEIYDRLVMDDYEHVSIASLAPDLFCVTFSGLSK
SHMIAGYRIGWMVLSGNKALGKDYIEGLNMLSNMRLCSNVPAQSIVQTALGGYQSVGEYI
VPGGRIYEQREYVYKALNDIPGISAVKPKAAFYIFPKIDTARFNITNDEQFALDLLREKK
ILIIHGGGFNWDKPDHFRVVYLPRTEILKDATGKLADFLASYKQK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttggaaaatccagaaaattagataatgtgctttatgatgttagaggaccg
gtggtggatgaggcggcccgcatggaggaaaacggcacaaatgtgttgaagctcaatata
ggaaatcctgcgccgtttggcttcaggacacctgatgaggtgatatatgatatgtctcgc
cagctcacggactgtgaggggtattccaactccaagggacttttttctgcaagaaaagca
atcatgcaatatgcacagctcaaaaagcttcctaatgtgacggttgaggatatctacacc
ggaaacggagtcagcgagcttataaacttaagcatgtcagcgcttcttgacaatggtgat
gaggtgctggtgccggcaccggactatccgctttggacagcctgcgttacacttgcggga
ggcacggcagtgcactatatctgtgatgagcagtcagagtggtatccggacatagaggat
atcaaaaagaagattacagacaagacaaaggcaatcgtaataatcaaccctaataaccct
acaggagcgctctatccaagggaggtgctgcagcagatagttgatgtggcaagagagcac
gagcttatgattttttcggatgagatatatgacagacttgtgatggatgactatgagcat
gtgtctattgcgtcgcttgcaccggacctattctgtgtgaccttcagcggtctttctaag
tcacatatgatagcaggctatcgtatcggatggatggttttaagcggcaacaaggcgctc
ggaaaggactatatcgagggtctcaacatgctctcaaacatgcgtctttgctcgaatgtt
ccggcgcagtcgatagtgcagacagctttaggcggatatcagagtgtaggcgagtatatt
gtgccgggcggacgaatctatgagcagagagagtacgtctacaaggcattaaacgatata
ccgggaatttcggcagtaaagccaaaggcagcattttacatattcccaaagattgatact
gcaaggttcaacatcacaaacgatgaacagtttgcacttgatctgcttcgtgagaagaag
atactcatcattcacggcggcggcttcaactgggataagccggatcacttcagagtggta
tatctgcctagaacagagatattaaaggatgccacaggcaagcttgcagactttttggct
tcatataagcagaaataa

DBGET integrated database retrieval system