KEGG   Eubacterium rectale M104/1: ERE_21910Help
Entry
ERE_21910         CDS       T02588                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
era  Eubacterium rectale M104/1
Pathway
era00860  Porphyrin and chlorophyll metabolism
era01100  Metabolic pathways
era01110  Biosynthesis of secondary metabolites
era01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERE_21910
Enzymes [BR:era01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ERE_21910
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ERE_21910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: CBK94077
UniProt: D4JKD0
Position
complement(2243597..2245084)
Genome map
AA seq 495 aa AA seqDB search
MRENTGKVVLVGVGPGDTGLLTLKGEKYIKQADCLVYDRLSSPEFLSMAKAGCELIYVGK
ENHKHVMKQDAINELLYEKSKYHELVVRLKGGDPYVFGRGGEEALYLVDRNVEVEVVPGV
SSSVAALAAAGIPITHRGIAKGFQVITAHSRKDEEADIDYSLLTDETITCVFLMGLAHVK
SIAAGLMKAGRRADTPAAVISNGTLAAQRKCIGTLADIGEKIEEAKLTSPAIIVVGDVVS
LNDRLDFFEKRPLFGRKITVPYIKTNELIAKLQQLGADVTPVKTGIINPIIIPEFADKVR
SADWIVFTSKNGVRSFFYNLELAGADIRLIANARFAVVGKATEKELVKHHINADIIPAEQ
TGKELAGELSSYMGDNDEIKVCIFSAKEASPDLEAGLKEICELEKIDAYVNEQAYESIPE
SIGNMVSEAVFTSASNVERFFHMLPENAYVETAYSIGEKTTAALEQHNVREIVQADDSSY
EALVDKISYKDAFKD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaacacaggaaaagtagtattagttggagtaggaccgggagatacgggcctg
ctcactttaaaaggagaaaaatatataaaacaggcggattgtctggtgtatgacaggctg
tcatcaccagagtttctttcaatggcaaaggcaggctgtgagcttatttatgtgggcaag
gaaaatcacaagcatgtcatgaagcaggatgccataaacgagcttttgtacgagaaatca
aaatatcatgagcttgtagtccggttaaagggcggagatccgtatgtatttggaagaggc
ggagaggaagctctctacctggtagatagaaatgtggaagtagaagtggtaccgggtgtc
agttcatcggttgcagcgcttgcggctgcaggaatacctatcacacacagaggcatagca
aaaggctttcaggtcatcactgcgcacagcagaaaggatgaggaggcagatatagactat
tcccttcttacagatgagacaatcacctgcgtatttttgatgggacttgcgcatgtaaaa
agcattgcagcagggcttatgaaagcaggacgaagagcggatactccggcagcagtgata
tcgaacggtacacttgccgcgcaacgcaaatgcataggaacgcttgcggatatcggagaa
aagattgaggaagcaaagctgacatcaccggctataatcgttgttggagatgtggtttca
ctgaatgacaggcttgatttctttgaaaaaagaccactgtttggaagaaaaattacagta
ccgtatatcaaaacaaacgaattgatagcaaaattacagcagcttggagcagatgtcaca
ccggttaagacaggcataataaacccgataataattcctgaatttgccgataaggtaaga
tcagctgactggattgtttttacaagcaaaaatggtgtaagatcatttttctataatctg
gagctggcaggggcagacatcaggcttatagcaaatgcaaggttcgcagtggtgggaaaa
gctacagaaaaagagcttgtaaagcatcacataaatgcagatattattccggcagaacag
accggaaaagaacttgcaggagaattgagttcgtatatgggcgataatgatgaaatcaaa
gtctgcattttctcggcaaaggaggcttcacctgaccttgaggcaggacttaaagaaata
tgtgaattagaaaagattgatgcatatgtaaatgagcaggcatatgagagtattcctgaa
agcattggaaacatggtaagtgaagctgtttttacaagcgcatcaaatgtggaaagattt
tttcatatgctgccggagaatgcatacgtggaaacagcatactcaataggtgaaaaaaca
acagcagcattagagcagcacaatgtcagagagatagtacaagctgatgatagcagttat
gaagcgctggtagataaaatatcttataaagatgcttttaaagattaa

DBGET integrated database retrieval system