KEGG   Eubacterium rectale M104/1: ERE_23730Help
Entry
ERE_23730         CDS       T02588                                 

Definition
Endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
era  Eubacterium rectale M104/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:era00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2423565..2424725)
Genome map
AA seq 386 aa AA seqDB search
MKKYIALVLAAVLVLGIFTGCGNKGNKETESQTDEKATESVNSAENNTEDSTQSSTENQN
VADTEQLTTENGQESSVLACPSVNGKLHVEGSKLVDQNNNEVQLRGVSTHGLAWYPQYVT
NDCFATLKSFGANVVRLAMYTYESGGYCTDGDRQQLETLVQNGVQYAFNNDMYVIIDWHV
LNEGNPNRYSDVAKTFFAKMAQQYASYNNVIYEICNEPCKGATWGDVKFYASEVIPSIRS
YDKDAVILIGTPNWSQDVDDAVKDPVTGYDNIMYTLHFYAATHKEDLQNKLKSAADAGLP
IFVSEFGICSADGNGQVDIDSANSWISLLDSYGISYVCWNLSNKDEKSALLTPACDKTSG
FTYEDLSDEGKWLYGVLTSHVTPVLN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatatagcattggtattggctgcagtgctggtgcttgggatttttacagga
tgtggtaacaagggcaacaaagagacagaatcacagacagatgagaaagccactgagtcg
gtgaattctgcagaaaataatactgaggacagtacgcaaagcagtacagaaaatcagaat
gtggctgatacagagcagctcaccacagaaaacggacaggagagctcagttcttgcctgt
ccgtcagtaaacggtaagctgcatgtggagggcagcaagctcgttgatcaaaataacaac
gaggtgcagcttcgcggagtcagcacacacggtcttgcgtggtatccacagtatgtgacc
aatgattgctttgccacgctgaaaagctttggagcaaacgtggtgaggctcgccatgtac
acctacgaaagcggtggctactgcacagacggtgacaggcagcagcttgagacacttgtg
caaaacggagtgcagtacgcgttcaacaacgacatgtatgtcatcatcgactggcatgtg
ctaaacgagggcaatccaaaccgctacagtgatgtggcaaagacattttttgccaaaatg
gcacagcagtatgcctcatacaacaacgtgatttacgagatttgcaatgagccgtgcaaa
ggtgcgacctggggagatgtgaagttttatgccagcgaggtcattccgtcaatcagaagc
tacgacaaggatgcagtcatactgataggcacacctaactggagccaggatgtggatgat
gcagtcaaggaccctgtcacaggctatgataatatcatgtatacactgcatttctatgcc
gcaacccataaggaggacttgcaaaacaagctaaaatcggcggcagatgccggactgccg
atatttgtatcagagtttggcatctgcagcgccgacggaaacggtcaggtggacatagat
tccgcaaacagctggatcagcctgctcgacagctacggcatcagctatgtgtgctggaat
ctgtccaataaggacgaaaaatcagcgcttctaacacctgcctgcgataagacaagcggc
tttacctatgaggatctaagcgatgagggcaagtggctgtacggtgtgctcacaagtcat
gtgacaccggtcttgaattaa

DBGET integrated database retrieval system