KEGG   Eubacterium rectale M104/1: ERE_24700Help
Entry
ERE_24700         CDS       T02588                                 

Definition
maltooligosyl trehalose synthase (EC:2.4.1.7 5.4.99.15)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
era  Eubacterium rectale M104/1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ERE_24700
Enzymes [BR:era01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ERE_24700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2535802..2537277)
Genome map
AA seq 491 aa AA seqDB search
MNNKPMLNAYPDSLGGKLSDIAALLKKKEMQDTFSSFYILPSLYHSDLDRGFSVVDYNLN
EELATIEDLSQLKELGIDLKLDFILNHASAQSPQFKDLVEKGDESEYRDFFIDWNKFWEG
HGVMTDEGYIQPDESCLKQMFFRKPGLPILMVEFPDGRRVPYWNTFYQEVHGREYLGQMD
LNIKSEKVWDFYRETLEKIASYGAAIVRLDAFAYAPKAPGKKNFLNDPETWEFLQQIHEL
AAPLGLTLLPEIHAAYEEKIYKTLADKGYATYDFFLPGLIIDAIENRRADYLAKWAREIV
EDKISTVNMLGCHDGIPLLDLKGLLPEDDIRSLIDLIVSRGGMVKNLHGQKNIYYQVNAT
YYSALGESDSKMLLARAIQMFMPGKPQVWYLDLFAGKNDHEAVRRAGESGHKEINRTNLS
ASDIREALKKDVVAKQLELLRMRNTHKAFEKGAVITVAGEGPKLSIRYDNGEAYALLTVD
FEAGAYEIELS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaacctatgcttaatgcatatcctgacagtctgggcggtaagctttccgat
atcgcagcgttgctcaaaaagaaggaaatgcaggacacattttcatcattttatattctg
ccaagcctgtatcattcggatttggaccgcggattttcggtcgtggactacaatctgaat
gaggagcttgcgacaatagaggatttatcgcaattgaaggagctggggattgacttaaag
cttgattttattttaaaccatgcttcggcacagtcaccacagttcaaggatctggttgaa
aagggcgatgagtctgagtaccgggattttttcatagactggaacaagttctgggaaggt
catggagtcatgacggacgagggctacatacagcctgatgagtcatgcttaaagcagatg
tttttcagaaagccggggcttccgattctcatggttgagtttccggatggacgaagggtg
ccatactggaacacattttaccaggaggtgcatggcagagagtatctgggacagatggat
ttaaatataaagtccgaaaaggtgtgggatttctatcgtgaaacactggaaaaaatagca
tcctacggtgcggctatcgtgagactcgatgcatttgcctatgcgcctaaggcaccggga
aaaaagaattttctgaatgatcctgagacctgggaatttctacagcagattcacgagctt
gcagcaccgcttggactgactctgctgcctgaaatacacgcggcatatgaggaaaaaata
tacaaaactcttgcagataagggctatgccacatatgatttctttttaccgggactgata
attgatgcgattgagaacaggagagcagattatctggcgaaatgggcgcgtgagattgtg
gaagataaaatctcaacagtcaatatgcttggctgccatgacggcatacctcttctggac
ttaaagggtctgcttccggaggatgatatacgctcgcttatagatttgattgtatctcgt
ggcggcatggtcaaaaatcttcacggacagaagaatatatattatcaggtcaatgccaca
tattacagtgcgcttggtgagtctgacagcaaaatgcttctggcacgtgccattcagatg
tttatgccgggcaagccgcaggtatggtatcttgacctctttgcaggcaaaaatgaccat
gaggccgtaagacgcgccggagaatcaggacacaaggaaattaacagaacaaaccttagt
gcctccgatatcagggaggcgctaaaaaaggatgttgttgcaaagcagcttgagctgctt
cgcatgagaaatacacataaggcatttgagaagggggctgtcataacagtagcaggagaa
ggaccaaagctctcaatccgctatgataacggtgaagcgtatgcgcttcttacggtggat
tttgaagccggagcatatgagatagagctgagctga

DBGET integrated database retrieval system