KEGG   Eubacterium rectale M104/1: ERE_26410Help
Entry
ERE_26410         CDS       T02588                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
era  Eubacterium rectale M104/1
Pathway
era00340  Histidine metabolism
era01100  Metabolic pathways
era01110  Biosynthesis of secondary metabolites
era01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ERE_26410
Enzymes [BR:era01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ERE_26410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBK94480
UniProt: D4JLI3
Position
complement(2705155..2706444)
Genome map
AA seq 429 aa AA seqDB search
MRTLKLTKDSQKNILESLLKRSPNNYTEYESTVNEIINNVKENRDKAVFEYTKKFDKADV
DASNIRVTEEEIKEAYELVDEKLLAVIKKALVNIRKYHEKQLQNSWFTTEDGIILGQKVT
PIAKAGVYVPGGKAVYPSSVLMNVLPAKVAGVEKIVMCTPCGADGKVYPSTLVAANEAGV
DEIYKVGGAQAIAAMAFGTESVPKVDKIVGPGNIFVALAKKAVFGYVSIDSIAGPSEILV
LADETANPRYVAADLLSQAEHDEMASAILITTSEELARKVSEEVDKFVEVLSRKEIIEKS
LENYGYILVAEDMDEAIDAVNDIASEHMEIVTRDPFSVMTKIKNAGAIFIGEYSSEPLGD
YFAGPNHVLPTNGTAKFFSALSVDDFIKKSSIISYSREALERIHTDIEQFAECEKLTAHA
NSIKVRFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaactttaaaacttacaaaggattcacagaagaacatattggagagcctgcttaag
agaagccctaacaactatacagagtatgagagcacggtaaatgagattataaacaatgta
aaggaaaatcgtgacaaggctgtttttgaatacacaaagaaatttgataaagcggatgtg
gatgcatcaaatatccgtgtcacagaggaagaaataaaggaagcatatgagctggttgat
gagaagcttcttgccgttataaaaaaggctcttgtaaatatcagaaaatatcacgagaag
cagctgcagaactcatggtttacaacagaggacggcatcattttaggacagaaggtcaca
cctatagcaaaggcaggagtatatgtgccgggcggcaaggctgtctatccttcatctgtg
ctgatgaacgtgcttcctgcaaaggtagcaggcgttgaaaagatagttatgtgtacacca
tgtggagctgacggcaaggtatatccttccacacttgtagccgcaaacgaggccggagta
gatgaaatctacaaggtaggcggtgcacaggctatcgctgcaatggcatttggtacagag
agtgtgccaaaggtagataagattgttggaccgggaaatatctttgttgcccttgccaaa
aaggctgtgtttggatatgtcagcattgattcaatcgcaggtcctagcgagattttggtg
cttgcagatgagactgcaaatccacgctatgtggcagcagatttactctcacaggccgag
catgatgagatggcatcagctatcttgatcacaacaagtgaggagcttgcaaggaaagta
tcagaggaagttgataagtttgttgaggtcctctcaagaaaagaaatcatcgagaaatct
cttgaaaactacggatatatacttgttgcagaggatatggatgaggcaattgatgcagta
aacgatatcgcttcagagcatatggagattgtcacaagagatcctttctcagtcatgaca
aaaatcaaaaatgcaggagcaatctttatcggagagtactcatcagagcctttaggagac
tactttgcaggaccaaaccatgttctgcctacaaacggaacagcaaaattcttctcagca
ttatctgtagatgactttatcaaaaagtcaagcatcatctcatattcaagagaagcactt
gagagaatacatacagatattgagcagtttgcagagtgtgagaagcttacagcacatgca
aattcaatcaaggttagatttgaggattag

DBGET integrated database retrieval system