KEGG   Eubacterium rectale M104/1: ERE_26780Help
Entry
ERE_26780         CDS       T02588                                 

Definition
(RefSeq) glutamate 5-kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
era  Eubacterium rectale M104/1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ERE_26780
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ERE_26780
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ERE_26780
Enzymes [BR:era01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ERE_26780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2739880..2740794)
Genome map
AA seq 304 aa AA seqDB search
MRNVIMYAFRLTIGKMIEMSFLDNYKRVVIKIGSSTLTHAETGSLNFSKMERLVRSICDY
RNSGMDVCLVSSGAIAVGRDVIGIKERPSDISIKQACAAVGQGRLMMTYQKLFSEYNQNS
GQVLMTKNTIVNPVSRRNVMNTFEELFALNVVPIVNENDTVSTYEMQFGDNDTLSAIVTS
ITKADLLILLSDIDGLYSDDPHDNPDAKLIREVDTLDRKILGMAKSSTGSDVGTGGMATK
LTAAKIATYSGADMIIANGGNMGILYDIMNDRYTGTLFHRAKDAEFVLADYIQREMAPTS
TGGQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgtaattatgtatgcatttagacttacaataggaaagatgatagaaatgagt
tttttggacaattataaaagagtggtaataaagataggttcatcgacgctgacacatgca
gagacgggaagcctcaatttttcaaagatggagcgtctggtgcgctcgatatgtgattac
agaaacagcggtatggatgtgtgcctcgtaagctccggcgccatcgcggttggacgggat
gtgataggcataaaggagcgcccgagcgatatttcaataaagcaggcatgcgccgcagtg
ggacagggcaggcttatgatgacatatcagaagcttttttccgagtataatcagaattcc
ggacaggtgcttatgacaaaaaataccatagtcaatcctgtttccagacgcaatgttatg
aatacatttgaggagctttttgctctgaacgtggtgcctattgtcaatgaaaatgatacg
gtaagcacatacgagatgcagtttggtgacaatgatacgctgtctgctatagttacatcg
atcacgaaggctgatctgctcatactgctatctgatatagacggactgtattccgacgat
cctcatgacaatccggatgcaaagcttatcagagaggttgatacgcttgacaggaaaata
cttggcatggcaaagtcatcaaccggcagcgatgtcggaaccggcggcatggcgacaaag
cttacagcggcaaagattgccacatattccggggccgatatgattatcgcaaacggcggc
aatatggggattttatatgacattatgaatgacagatatacaggaacacttttccacagg
gcaaaggatgcagagtttgtgcttgcggattatatacaaagagagatggcacctacatct
acaggcggccagtaa

DBGET integrated database retrieval system