KEGG   Eubacterium rectale M104/1: ERE_28420Help
Entry
ERE_28420         CDS       T02588                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
era  Eubacterium rectale M104/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:era00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ERE_28420
Enzymes [BR:era01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ERE_28420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2915794..2917368)
Genome map
AA seq 524 aa AA seqDB search
MRTSGVLMPISSLPSQYGIGTMGKEARRFVDFLEKGGQTYWQILPICPTSYGDSPYQSFS
SFAGNPYFIDLELLCKDKLLTKKECESYKWGKKPQYVDYGIMYVNRYALLRKAYERFSKK
TPADYEAFCSKEAEWLDEYTLFMALKDANGGVAWSEWDDALKFRKPEAMEEAKEKYADDI
AFYKMLQYLFFKQWTALKAYANEKGIRIIGDVPIYVAMDSADVWANPTQFYLDKDLNPIE
VAGCPPDAFSADGQLWGNPLFRWDVMKKDSYSWWTKRISAMAKLYDIVRIDHFRGFDSFY
AIPAKDDTAKNGVWKDGPGMDLFNVLEKKLGKLPIIVEDLGFLTPSVKKLLKDSGFPGMK
VIQFAFDSREDSDYLPHNYPQHCVVYTGTHDNDTVMGWMKTAPKDCVRFAKDYLNLTKEE
GYNWGMMRAAWSSVADMAIVPMQDLLGLDSKARINIPSTTGGNWQWRATPEQIDNKLAKK
LHKCMQMYARLREEPEEASDKSDAKETADTSTSKTAGCEKKAAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagaactagcggtgtattaatgccaatctcatcactgccatcacagtatggtattgga
actatgggaaaggaggcaagacgttttgtcgatttccttgagaagggaggtcagacatac
tggcagattcttccaatctgtcctaccagctatggagattctccataccagtcattttca
agctttgcaggcaatccttattttatagatcttgagcttttatgcaaggacaagcttctg
acaaagaaggagtgcgagtcatataagtggggcaaaaagccacagtatgtagactatggc
attatgtatgtcaacagatatgctcttttaagaaaggcatatgagcgtttttcaaagaaa
acaccggctgactatgaggcattctgcagtaaagaggcagagtggcttgatgagtacaca
ctctttatggcattaaaggatgccaatggcggagtggcatggagcgagtgggatgatgct
cttaagtttagaaaacctgaggctatggaagaagcaaaggagaagtatgcagatgatatt
gccttctacaagatgctccagtatctcttcttcaagcagtggactgctttaaaggcatat
gctaatgaaaagggcataagaattatcggagatgtacctatttatgttgccatggattca
gcagatgtatgggctaatcctacacagttctatctcgataaagacttaaatccaatcgag
gtggcaggatgtcctcctgatgccttctcagctgacggacagctctggggcaatcctctt
ttcagatgggatgttatgaagaaggacagctacagctggtggacaaagcgtatcagtgct
atggcaaagctttatgatatagtacgaatcgatcatttcagaggttttgattcattctat
gctattcctgcaaaggatgatacagcaaagaacggtgtatggaaagatggacctggcatg
gatttattcaacgtgcttgagaagaagcttggcaagcttcctatcatcgtggaggacctc
ggcttcctcacaccttccgtaaagaagcttttaaaggattcaggcttccctggcatgaag
gttatccagtttgccttcgattcaagagaagatagcgattatctgccacataactatccg
cagcactgtgttgtatacacaggtacccatgacaatgacacagttatgggctggatgaag
acagctccaaaggattgcgtaaggtttgcaaaggattacttaaacctcacaaaggaggag
ggctacaactggggcatgatgcgtgcggcatggtcatcagttgccgatatggctattgtt
cctatgcaggatctgcttggacttgattcaaaggcccgtatcaacattccttcaactacc
ggtggcaactggcagtggagagctactcctgagcagatagacaataagcttgcaaagaag
ctccacaagtgtatgcagatgtatgcacgtctgagagaggagcctgaggaggcttctgac
aaatcagatgctaaagaaacagctgatacttctacaagcaagacagcaggatgtgagaaa
aaggctgctaagtag

DBGET integrated database retrieval system