KEGG   Eremothecium cymbalariae: Ecym_1036Help
Entry
Ecym_1036         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Ecym_1036
Enzymes [BR:erc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ecym_1036
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Ecym_1036
  Exosomal proteins of colorectal cancer cells
   Ecym_1036
  Exosomal proteins of bladder cancer cells
   Ecym_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(67085..68629)
Genome map
AA seq 514 aa AA seqDB search
MLFNKKVMLALASGLALCARAEEATAPEDSKVVKLGLEDFRSFLKEHSLVLAEFYAPWCG
HCKRLGPEFVEAAAELVESEIYLAQIDCEKEKELCQEQSIGSYPTLKIFRNGEPELGTQY
MGDRKASSIVSYMLKQNEPSVRVVQGNDAAEQFAKIVKESEDILVVDGGVSDLNETFHEL
AESHRHSYSFVQYPESDSKLGLYLQGEEEPIYYNGDNFTIDSLTAWLKVESLPYFGDVDA
STFSSYRSSGLPVAYFFYTSPEERAEYEEFFVSLGKQYRGEIAFGGIDATKHGRFAESLS
VKQQFPLFVIHKMFDNLKYSLPQLSDEEYEALTTPLTLDKKQVTEFIKKFIAGKLEPIIK
SEEVPEVQENNVYKLVGKTHDDIISDKDKDVLVKYYAPWCGHCKTLAPVYEQLADLYASD
EDSKDKILIADIDATLNDVQVEIQGFPTIILYPAGKDSEPVTFESQRSVEAFVKFIAENG
AHKFDGKHLIKGNSGDAVTEDGVPAEEDLEHDEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcaataagaaagtgatgttggcgttagcctctgggctggcattgtgcgctagg
gcggaggaggccacagcacccgaagactcgaaggtagtaaagttgggattagaggatttt
aggagtttcttgaaagagcattcattggtgttagcggagttttatgctccatggtgtgga
cattgtaagagattaggtcctgaatttgttgaggcagcagctgagctagtggagagtgag
atttatttagcacaaatcgactgtgaaaaggagaaggagctatgtcaggaacaatctatc
ggaagttatcctactttgaagatatttagaaatggtgagccggagttgggtacgcagtat
atgggggacagaaaagcttcttccattgtaagttacatgttgaagcagaacgagccctct
gtgcgtgttgttcaagggaatgatgctgccgaacagtttgccaagatagttaaggagtct
gaagatatacttgttgttgatggaggtgtttctgatttgaatgaaaccttccatgagctt
gcggaaagtcacagacactcttattcttttgttcaatatcctgaaagtgattcgaagttg
ggtctctatttgcaaggcgaggaggagcctatttattacaacggcgataacttcactatc
gacagtttgactgcttggttaaaggttgaaagtcttccttatttcggtgatgtggatgcc
tctactttcagttcttacaggtccagtggtcttccagtcgcttatttcttctatacttct
cctgaggagcgtgcagagtatgaagaatttttcgtcagtttaggtaaacagtacagaggt
gagattgcgttcggtggtattgatgctaccaaacatggtagattcgctgaaagcttgagt
gtcaaacaacagttcccattgttcgttatccacaaaatgttcgataatttaaaatacagc
ttaccacagttatctgacgaggaatatgaggcgttaactactcccttgactctagataag
aagcaagtcacggaatttatcaaaaagttcattgctggtaagttagaaccaataattaaa
tctgaagaggtcccagaagtccaagaaaataacgtttacaagttagttggtaagacccac
gatgatattatttctgacaaagataaggacgttctagtcaagtactacgcaccatggtgt
ggacactgtaaaactttagcccctgtgtacgaacagttagccgacctatacgcctccgac
gaggatagcaaagataagatcttgatcgctgatatcgacgctacattgaatgacgtccaa
gttgaaatccaaggtttcccaacgattattttgtacccagctggtaaagactctgaacct
gttaccttcgaatcccaaagatctgtagaggctttcgtaaaattcatcgctgagaatggt
gcccacaagtttgatgggaaacatctaataaagggcaattccggagacgctgtcaccgaa
gacggagtgccagcagaggaggatctggaacatgatgagttatag

DBGET integrated database retrieval system