KEGG   Eremothecium cymbalariae: Ecym_1119Help
Entry
Ecym_1119         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
erc  Eremothecium cymbalariae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:erc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(244327..246702)
Genome map
AA seq 791 aa AA seqDB search
MRRVGELRDAVYIHKLSLNALVGPDRWNRVTPQKLLMSMKMVTDFRESSATDDLKYSLDY
AKISSDITEFVTTRDHLSLRELGKSVVDYSISKYEGIEALELEVNCPTSHIRCGSVDVIV
SSNPHVDDIIVISDLKLLTLVGIFNFERLTKQFVNFNISFSLLKGYKMLSIKSIIDNVIS
SVENAEFKTVEALVEEVARVVTSDDYFQANKSVEVKIKVLKLNALMETQGVGVSCIRSLN
DLCGKGAQVNKVKFNFGGNLPIMQEQRIGETECYTAMLAVGSNSGDRFKNIVECINLLKD
DIKVDVIQVSSLFETKPMYFEDQKRFFNGVIEIRTQHDPLELLKLCKRIEYEDMKRVKLI
ENGPRCIDLDIVMMKKSDGQHVLWNSDELVIPHSRMLERTFVLEPLCELVAFSEVHPITG
EFLHDRLKELYETGNNEQLLQKLVPLPQANFKSITDCRFLTFETAYERDAITGTLIRQTT
SNTQIMGILNVTPDSFSDGSSDYRNVKYHVDKVKKMVEEALTFQKFVIIDVGGCSTRPGA
LQIDLQEELTRVIPVIRNIRECSELPQDRIVLSVDTYRSEVAKAAIEAGVDMVNDISGGR
LDANMFKVIAANPNIAYVLSHIRGDISNMMNMVEYGDEVSSIAVEEFICGRRDSLVGTEL
VRNVAREIAESFLKAMTAGVKRWQIILDPGIGFGKTGKQNVEIIKHIPVLKNYSCVKDNR
FVSFSNLPVLLGPSRKKFIGTIIQESDAEKRDVVIGAVAASCVGYGVDIFRVHDVSNSSR
IIKLADALYRS
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgttggtgagcttagggatgccgtttatatccataagctatctttgaatgca
ttggtaggaccagaccggtggaatagagttactcctcagaagttgcttatgagtatgaag
atggtcacagattttcgtgaaagtagtgcaactgatgatctgaagtattctttggattat
gctaagatatctagtgatattaccgagtttgttaccactagggatcatctatctttacgg
gagttgggtaaatcagtggtagattattcaatcagcaagtatgaaggtattgaagcatta
gaattagaggttaattgtccaacaagtcatataagatgtggtagtgtggacgttattgtg
tctagtaatccgcacgtggatgatatcatcgttatatcagacttgaagttgttgacccta
gtaggtatttttaatttcgaaaggcttacaaaacagtttgtcaactttaatatttcgttc
tcactgctcaagggctataagatgctgtctatcaagagtattattgataatgttattagt
tctgtagagaatgctgaattcaagactgtggaagctttggtagaggaagtggcacgggtt
gttacttctgatgactattttcaggctaataagtccgtggaggttaaaattaaagttttg
aaattgaatgctctaatggaaacgcaaggtgttggtgtgagctgtattagatcgctgaat
gatctgtgtgggaaaggggctcaagttaataaggtaaagtttaattttgggggtaatctt
ccgattatgcaagaacaacggattggtgaaactgaatgttacactgcgatgttagctgtt
ggttcaaattctggagataggtttaagaacatagtagagtgcattaatttgttaaaagat
gacataaaggtggatgttattcaagtatcgtctttatttgagactaagcctatgtatttt
gaagatcagaagaggttttttaatggtgtcattgagattcgaacacagcatgaccccttg
gaattgctaaagctatgcaaacggattgagtatgaagatatgaaaagagttaaacttatt
gagaatgggcctagatgcattgatttggatatagttatgatgaaaaaatctgatgggcaa
catgtgctttggaattctgatgaattggttattcctcacagtagaatgctggaaagaacg
tttgttctagagccattgtgtgaacttgttgcttttagtgaagtacatcctataaccgga
gagttcttgcatgataggttaaaggaattgtatgagaccggtaataatgagcagttattg
caaaaattagtaccactccctcaagcgaacttcaaaagtattactgattgccgattttta
acttttgaaactgcatatgaacgtgatgctattactgggacgttgattcgacagactaca
tcgaatacccaaataatgggaatattaaatgttactccagattcgttttcggatggttca
tctgattatcgtaatgttaagtaccatgttgataaagttaaaaagatggttgaagaggca
ctcaccttccagaaatttgttattatagatgttggtggttgttcaaccagacccggcgct
ctgcaaatagatttacaagaggagctaactcgtgtcatacctgttattagaaatatcagg
gaatgtagtgagcttccgcaggatagaatcgtgctatcggttgacacttatcgttctgag
gttgcgaaagcggctattgaagctggtgttgatatggtgaatgacatatctggaggacgg
ttagacgcgaacatgtttaaagttattgcagccaatcctaatatcgcatatgttctatct
cacattcggggagacatttcgaacatgatgaatatggtagaatacggcgatgaggtctct
tctattgcagttgaggagtttatttgtggaagacgcgattctttggtcggaacagaattg
gtgaggaatgtagccagggaaattgcagaaagttttctgaaggctatgacagcaggagtt
aaacgttggcaaatcatcttggatcccggtatcggatttggaaagactggtaaacagaat
gtggagattataaaacatatacctgttttgaaaaactacagttgtgtgaaagataatcgg
tttgttagtttctctaatttgcccgtcttacttggaccatctcgtaaaaagtttataggt
accattatccaagaatcagatgcagaaaaacgtgatgtggttattggagctgtagctgca
tcatgcgttggatacggcgtggatatttttagagttcatgatgtctccaattctagtagg
attattaaattagcagatgctctatataggagctaa

DBGET integrated database retrieval system