KEGG   Eremothecium cymbalariae: Ecym_1163Help
Entry
Ecym_1163         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ecym_1163
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ecym_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(330737..335299)
Genome map
AA seq 1520 aa AA seqDB search
MSKELENSVVLINSTDSQGALAHWFISCSSFIGSLFANGFYVVSKVIQFVFLGMTSAAIS
YISYSGASFYLLALCGALLPLLTHLILKSRVFSAYSLLKRDIDDDMFAKNRQMIEDNEAI
FMNTSEDKRRSGFASYLDEFLSAIKIFGNLDKLVFHELTKSMRTQRLEQDEVMLLDDSVG
FSIVVEGTLQIYHKIATPHENSNSHNGAKPVTDDYQYETTDDDLRVNGERFQLLNKVTAG
NHVSSLVSILKLFTDNQAPMTETNGLGAKSPSTECIVDTSFRPSVFPFLDSLQEPQNVDI
ALTKAYQKYDVSLQNMPNAPTPSYSPVPRHIDDSPISNHSIVEKSSESLPEIVAYASTDC
TVAVIPASAFKRLMVKYPRSASHIIQMILTELYRVTFQTAHSYLGLTKEIMYTEVLLNRR
VNFELPYYLQDALLKSIQRKSNELPSQENIHRHQRGSARNISQGSTKGSRHIALESRDQF
NPGDLLSNVPLSRKDFSCRTTNASSGLSRAQKYSKDNSSTNITLHQGEPHNSNSHHPSIS
SPSTLSTKTSKINLNENPNSYSFSAAEETEESAWRMALVESIFGYLGITNENIMPPNEDS
FLVKHRRTSSASLCSSFASVSQTKSLNQEVFKCLSPEKVKIRKKAQRAKYAEKEPLNLDF
NSAKVEFAQGLETMFISSGTILLEQNANSKGLYYIVSGELEVCSKAEEDLVEHVLYTVKP
GGIAGYLAAVIGFKSFVSLRAKTDLYVGFVALGVLEKLCDKYFMIYLRIAETLTNLLSPK
ILKLDYALEWVHLEASETLFKQNDPANAIYVVLNGRLRQLHQRTKTQEPLEEKLSSLRRK
KTRKELNKRHVQVIGEYSQGCSFGEVEVITAVNRLSTVVAVRDTELARIPRTLFEVLALE
HPSIMIRVSRLVARNILQKHSDSDEPTKIMNNANGYRYDFNLMIPSSVSSSSWGSDSFSW
AINYKTITILPITQGLPVEEFATKLVSAFKQVGRTTIGLTQSTTLSHLGRHAFDKLANLK
QSGYFTQLEELYEVVVYIADTPINSSWTSTCISQGDCILLLADATSEPDIGEYERLLLKN
KTTARTELLLLHPERYVEPGLTHKWLRNRMWVHQHHHMQFVSSQKHSERSEPKSGVNFLN
PASVFMERLRQKERLNQLTKKTQENFVKLLPDSIKSTMENISLKYIQRKQKYYTPVYAHK
NDFLRLARILSGQAIGLVLGGGGARGISHLGVLKAIEEHGIPIDMIGGTSIGSFVGGLYA
KDYDLVPIYGRVKKFAGRIGSLWRMLSDMTWPVTSYTTGHEFNRGIWKSFGDIRIEDFWI
QYYCNSTNITESVQEIHSSGYAWRYIRASMSLAGILPPLTDNGSMLLDGGYLDNLPVSEM
KSRGCKTIFAVDVGSVDDRTPMEYGDSLNGFWILFNRWNPFSKHPNIPNMAEIQMRLGYV
ASVNALEKAKSTPGVIYFRPPIEPYATLDFAKFEEIYQVGAAYGRMFFQELEKTGNMPKI
PGNEPFSAQGMHLQHRRNSI
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagagcttgaaaattcagtggtgttaataaactctactgattctcagggagct
ttagcgcactggtttatatcctgctcatcctttatcgggtcattatttgctaatggattt
tatgttgtttcgaaagtgattcaatttgtgttccttgggatgacttctgctgcaataagt
tatatttcctattctggtgcatcattttatttattggctttatgtggagctctcctaccc
cttctcacgcatcttattcttaaaagtcgtgtgttctcagcttattcccttttgaagcgc
gatatagatgatgatatgtttgccaaaaacaggcagatgatcgaggataatgaggcaatt
tttatgaatacatctgaggataaacgcaggtctgggtttgcatcctaccttgacgaattt
ctgagtgctatcaaaatctttggaaatctcgataagttggtgttccatgaacttactaaa
tcgatgagaacccagcgtctagaacaggatgaagttatgctgcttgatgactctgttggg
ttttcaattgttgtggaagggactttgcagatttatcataagattgctacacctcacgaa
aacagcaacagccataatggcgcgaagcctgtaacagatgactaccagtatgagaccaca
gacgatgatctaagagttaacggtgaaagattccaattgttaaacaaggtcacagcggga
aaccatgtctcttcccttgtaagcatccttaaacttttcacagataaccaggcccctatg
acggagacaaatggcctaggagccaaaagtccatcgactgagtgtattgtagatacttcc
tttcggccctctgttttcccgttcttggattccctacaggaaccgcagaacgtagacata
gctttaaccaaggcgtatcaaaaatatgacgtttcacttcagaatatgcccaatgcccca
accccatcctattcacctgtacccagacacatcgatgattctccaatttctaatcatagt
atagttgaaaaaagttctgaatctcttccggaaattgttgcatatgcttctacagactgc
acagttgcagtgatccccgccagtgcgtttaagcggctaatggtaaaataccctcggtct
gcctcccatattattcaaatgattctcacagagttgtatcgtgtcactttccaaacagcc
cattcttacttagggttgactaaggagattatgtacacagaggtattattgaataggcgt
gttaattttgagttgccgtattacttgcaggatgcgctattgaagagtatacaaaggaaa
tcaaacgagttaccttctcaagaaaatattcacagacatcagagaggtagtgcaaggaat
atctctcaggggtccaccaagggttctcgtcatattgcccttgaatccagagaccaattt
aaccctggcgatttgttatctaacgttcctttatcacggaaggacttcagctgccgtact
acaaatgcttcttcaggtttatctagggcgcagaaatactcaaaggataatagtagcacc
aatataactttacatcaaggagaaccacacaattctaatagccatcatccttcaatctca
tctccgtcaacattgagtacaaaaacctcaaaaataaacttaaatgagaatcccaattcc
tattccttttctgcagcagaagaaaccgaggaatctgcttggagaatggcacttgttgaa
agcatatttggttatttgggtattacgaacgaaaatatcatgcccccaaatgaggatagt
ttcctagtgaagcacagaaggacttcaagcgcatcgttgtgttcatccttcgcatctgta
tcccaaacaaaatcattaaatcaagaagtcttcaagtgtttatctccggagaaagtcaag
attagaaagaaggcccaacgtgccaaatatgctgaaaaggaaccactaaacctagacttt
aattctgccaaggtcgaatttgctcaaggtttggaaacgatgtttatttcgagcggaact
attttgttggaacaaaatgctaatagtaaagggttgtattatatcgtatcaggtgaatta
gaggtttgctccaaagctgaggaagaccttgttgagcatgttctttacacagtaaaacct
ggtggtattgcaggatatttagcagctgtaataggttttaaatcctttgtttcattgagg
gctaaaacagacttatatgttgggttcgtggcactaggagtgctagaaaaactttgcgac
aaatatttcatgatttatttgagaattgcagaaacgttgaccaaccttctaagtcctaaa
atactaaaattggactatgcattggaatgggtacacttagaagcttctgaaacgctattt
aaacagaatgatccagcaaacgcaatttatgtggtgttaaatggcaggctcagacaatta
catcaaagaactaagactcaagaaccattggaagaaaaactttcatctttgaggagaaag
aagacaagaaaggaattaaacaagaggcatgtacaggttattggtgagtattctcagggt
tgtagctttggtgaggttgaagttataacagcagtgaatcggttatccaccgttgttgct
gtaagagacacggaactagcacgtattccaaggacgttgtttgaagtgcttgctttagaa
catccctcaataatgattcgcgtcagcaggcttgtggcgcgtaatatattgcagaaacat
tctgatagtgatgaacccacaaaaattatgaataatgcgaatgggtaccgatatgatttt
aatctaatgattccatcctctgttagcagctcaagctggggcagtgacagctttagttgg
gcaataaattacaagactatcactattttacctatcacgcaagggctaccagtggaagag
tttgccacaaaactggtttcagctttcaaacaagtaggaaggactactatcggattgact
caaagtaccacactttctcatttaggtagacatgcttttgataagttggctaacttgaaa
caatctggctattttactcaacttgaagaactctacgaggtcgttgtgtatattgcagac
acccctataaattcttcttggacctcaacatgtatttctcaaggagactgcattttgctt
ctagcagacgctactagtgaacctgacattggtgaatacgaacgtctgctattgaagaac
aagacaactgcaaggacggagttgttacttttgcatccggagcggtatgttgaacctggt
ttgactcataaatggcttcgtaatagaatgtgggttcatcaacaccatcatatgcagttt
gtcagttctcaaaaacattcagagagatcggagccaaagtccggcgtgaattttttgaac
cctgcatctgtatttatggagagacttcgccaaaaggagcgcttaaaccaattgacgaag
aaaacccaagaaaacttcgtaaaattattgccggactcgatcaagagcactatggaaaat
atttctctgaaatatattcaaaggaaacagaagtattacacccctgtttatgctcataaa
aatgactttctaaggctagcacggattttatctggccaagctataggcttagtgctaggt
gggggtggtgctcgtgggattagtcatttgggtgtcctaaaagccatcgaagaacatggc
atcccaatcgatatgattggtggtacttcaattggatcctttgttggtggattgtatgct
aaagattatgatttggttcccatctatggaagggtgaagaagtttgctggcagaattgga
tctttatggagaatgttaagcgatatgacatggcccgtcacttcttacacaaccggccac
gaatttaaccgtggtatctggaaatcatttggtgatattagaattgaggatttttggatc
caatattactgtaattcaacaaacattacagaatcggtccaggaaattcatagttctggt
tatgcatggaggtatatccgtgcttccatgtccttagccggaatattgcctccattgact
gataatggcagtatgttgcttgatggaggttatctagataatcttccagtttccgaaatg
aaatctcgtggatgtaaaaccatatttgctgtggacgtgggatctgtagatgatagaacg
ccgatggaatatggagattcccttaatggcttctggatattgtttaatcgttggaaccca
ttttccaaacatccaaatattcctaacatggcagaaattcaaatgaggcttggatatgta
gcctctgtaaatgctctagagaaggctaaaagtactccaggagtcatttatttccgtcct
ccaattgaaccctacgcaactttagatttcgcgaaatttgaagaaatatatcaagtgggt
gctgcatatggtcgtatgttcttccaagagctagagaaaacgggtaatatgcccaaaatc
ccaggtaatgagcctttctctgcacagggaatgcatctgcaacatagacgtaacagtatc
taa

DBGET integrated database retrieval system