KEGG   Eremothecium cymbalariae: Ecym_1212Help
Entry
Ecym_1212         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
erc  Eremothecium cymbalariae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:erc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Ecym_1212
Exosome [BR:erc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ecym_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(429036..433991)
Genome map
AA seq 1651 aa AA seqDB search
MSDLPIEFTELVDLTSLGISGKSLDFRSTTFESDRFVTVRETGNGVSSVAIVDLMNDNEV
TRKNMGGDSAIMHPSQMVISVRANGTLVQIFNLDTKQKLKSFQLDEPVIYWSWLSEEVLG
FVTANSLLTCNAFDGDVGRKPTRLASRHASLNNSQIINFVANKSLDWFAVVGIIQENGRI
AGKVQLFSKARNISQAIDSHVAMFASLMLDGNTEPVQVFVTGNRNVSTGVGELRIIEIDH
NMQANPVQYQKKTVDIFFPPDATNDFPLAVQVSEKYGIIYVLTKYGFIHLYELETGSNLF
VNRITAESAFTATHYNNRNGIACINKKGQVLAVEIDRTQIVPYVLNKLSNVPLALTIATR
GGLPGADELFQKQFNSLLDQGDYQNAAKVAASSQQLRTQTTINKLKNIQAPPGAISPILL
YFSTLLDKGKLNKHETIELAKPVLQQDRKQLFEKWLKEDKLECSEELGDVVRPFDTTLAL
ACYLRAKIHAKVITCLAELQQFDKILPYADKVGYQPNFVVLISDLLRSSPDKASDFATSL
LQSPQTNSNLDVEKIADMFFSQNHVQQGTSFLLDALKGDTPDQGHLQTRVLEINLLHAPQ
VADAILGNNIFSHYDRPTIAGLCEKAGLYQRALENYTNIKDIKRCITHTSALPVDWLVGY
FGKLNVQQSLACLRALMDADLDGNLQIVIQVASKFSDLIGSSVLIKLFEEYKSTEGLYYY
LVSLVNLSDDEDVVFKYIQAAVRIGQFQEVQRVIKSSNAYDPERVKNFLKDSDLPDQLPL
VIVCDRFDFVHDLVLYLYKTKKLNFVEVYVQQINPSKTPQVIAGLLDVDCDEQTIKNLLD
SVKGQYSIEELTTEVEKRNRLKILLPILEETLNNGTQDQAVYNALAKIYIDSNNSPEKFL
KENDQYDTLNVGLYCEKRDPYLAYIAYDKGTNDEALIRITNDNIMYKYQARYLLKRSALE
LWSVVLDEENIHRRQLVESIISVGIPELTDPEPVSITVQAFMNAGMKLELIELLEKIILE
PSPFTDNQALQGLLMLSAIRYDPSKVSDYIEKLEHYDADEIAPMCVEAGLYEEAFEIYDK
HERYDKALEVMVENIMSLDRAETYVEKIDKPEVWSQLGSAQLSGSRISESIDSYIKAQDP
SNYENVINITEEVEKYDELIPYLIMARKTLKEPKIDGALIMAYAKLNKLNEIENLLNGNN
VADLEDIGDQLVEAKNYKAAKLCYSSVSNYSKLATTLVYLKDYQAAVETARKASNVRVWC
QVNSACIDNKEFRLAQICGLNLIVHAEELEELVAKYESNGYFDELISLFEAGLGLERAHM
GMFTELAILYTKYDPPKTYEHLKLFWSRINIPKVIRATERAHLWQELIFLYAHYDEWDSA
ALTVIEKSADNFDHDYFKEIIVKVSNLEIYYRAINFYVKEHPTLLIDLLALLTPRLDIPR
AMKIFTKSDNLPMIKPFLISVLPKNNSVVNQAYHDLMIEEEDYKALQNAVQSYDKFDQLG
LAARLEKHDLIFFKKIAAQLYHRNKKWSKSLAILTENKLWKDAIDTAAISQNRQVAEDLL
NYFVETGNNEGFVALLYSAYNLIRYDFVLELAWLNGLETLIKPYEISVKKEQFYNIQNLS
KAVSKLSGKEADNAEQLLITNGSVDFQPAGF
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttgccgattgagtttacggaattggttgatcttacgtcgctgggtatttcc
gggaagtcattagactttaggtctacgacgtttgagagtgatcggtttgttacggtgcgt
gagacgggcaatggggtgagttcggtggctattgttgatttaatgaatgacaatgaggtg
acgaggaagaacatggggggggattctgcgattatgcacccgagccagatggttatttcg
gttagggcgaatggtacgcttgtgcagatcttcaacttggatacgaaacagaagttgaag
tcatttcagctggacgagcctgttatttattggagttggctgagcgaggaggttcttggg
tttgtcacggccaactctttgcttacttgcaatgcctttgatggggatgtggggcggaag
cctacgaggttggccagcagacatgctagtttgaacaacagtcagattattaattttgtg
gccaacaagtcgctcgactggtttgcggtggttgggatcatccaagaaaacgggcggatt
gccggtaaggtgcagttgttctccaaggctcgtaatatatctcaggcgattgatagtcat
gtggcgatgtttgcgtcgctgatgctggatgggaacacagaacctgtgcaggtgtttgtc
acaggaaacaggaatgtgtccaccggtgttggcgagcttcgtattattgagattgatcac
aacatgcaggcaaaccccgttcaataccaaaagaagactgtggacatctttttcccgcca
gatgctaccaacgacttcccgctcgcagtacaagtatccgagaaatacggtatcatttac
gtgttgacaaaatacgggttcattcatttatacgaactcgaaacaggttcgaatcttttt
gttaaccgtatcactgccgaatccgcgtttacggcgactcactacaataacaggaatggt
atcgcgtgtatcaacaagaagggccaagtgcttgctgttgaaattgatcgcacacagatt
gtgccctacgtcttgaataaactatccaacgtgcctcttgcactgactattgcaactcgt
ggcggattgcccggggcggatgagctctttcaaaaacagttcaattctctcttagaccaa
ggtgattatcagaatgctgcaaaagtcgctgcatcgtcgcagcaattgagaacacaaact
acgatcaacaaactaaaaaatatccaagcgccacccggagccatctcgccaattctctta
tacttttccactttactcgataagggcaagttaaacaagcacgagactatcgaacttgct
aaacccgttttacagcaggacaggaaacagctctttgagaagtggttgaaagaggataaa
ctagagtgttcggaagaattaggtgatgtcgtacgcccattcgatacgactttagcgttg
gcatgttacttgagggccaagatccatgcaaaggttatcacatgtctcgccgaattacaa
caatttgacaagattttaccgtatgccgacaaagttggctatcagccaaactttgtggtg
ctgatttctgatctattgagaagttcgccggataaagcttctgattttgcaactagtttg
cttcaatctccacagaccaattctaatcttgatgttgaaaagattgctgatatgttcttt
tcacaaaatcatgtccagcaaggcacctccttcttattggatgcgttgaaaggggacacg
ccagatcaaggccatttacaaacacgtgtattagaaattaatttactgcatgctcctcag
gtggcggatgcaatcttgggtaacaacattttttcacactatgacagacctacaattgcc
ggcttgtgtgaaaaggcagggttgtatcagagggctttggaaaattacactaatatcaag
gacataaaaaggtgtattacgcatacatctgctttacccgttgactggttagttggttac
tttggtaagttaaacgttcaacaatctttagcatgtttgagagcattaatggatgcagat
ttggatggaaacctccagatcgtaatccaagtggctagtaagttttcagacttgattggt
tcaagcgttttgataaaactctttgaagaatataaatcaactgaaggattatattactat
ttggtttccttagttaacctctctgatgatgaagacgttgtattcaaatatatccaggcg
gccgttaggattggtcaattccaggaagtgcaaagagttatcaagagctctaatgcttat
gatcctgagagagttaaaaactttttaaaagactctgatctaccagaccagctgccattg
gttattgtatgtgatagatttgattttgtccatgatcttgtattatacctgtacaagacc
aaaaagctcaactttgtagaggtttacgtccagcaaattaatccatcaaagactccacag
gttattgccgggttgttagatgtagattgcgatgaacaaactattaagaacttgttggat
agcgttaagggacaatattctatcgaagaattgactaccgaagtggaaaagagaaataga
ttaaagatcttgctccccattttggaagagactttaaataatggcactcaagaccaagcc
gtttacaatgccttggctaagatctatattgattctaacaattcacctgaaaagtttttg
aaagaaaatgaccaatatgacaccttgaatgttggtctttactgtgaaaaaagagaccct
tatttagcgtacattgcgtatgataaaggcactaacgatgaggcgttgattagaatcact
aatgacaatataatgtacaaatatcaagctagatatttgttgaaacgttctgctttggaa
ttgtggagtgttgtcttggatgaagaaaacattcataggcgtcaattggttgaatccatt
atcagtgttggaattccagaattaacggatcctgaacctgtttccatcactgttcaggca
tttatgaatgctggtatgaagctggaattaattgaattattggaaaagatcattttggaa
ccatcccccttcactgataatcaagctttacaaggcctactaatgttatcagcaattaga
tatgatccatcaaaagtttctgattacattgaaaagttggaacattacgatgctgatgaa
attgctccaatgtgtgttgaagctggtttgtacgaagaagcctttgaaatttatgataaa
catgaaagatatgataaagctttagaagtgatggtggaaaacataatgtcattggataga
gctgaaacgtacgttgaaaaaatcgacaaacctgaagtttggtctcagctaggttctgct
caattgagtggttctcgtatatctgaatctattgattcttatattaaggcacaggaccct
tcgaattatgagaacgttattaacattactgaagaagttgaaaagtatgatgaattaatt
ccatatttgattatggccagaaaaaccttgaaagaaccaaaaattgatggggctttgatc
atggcgtatgcaaagttgaacaaacttaatgaaattgagaatcttttgaatggaaataat
gttgccgatttagaagatatcggtgaccaacttgtagaagctaagaactacaaggctgca
aaactgtgctattcctcagtttccaactattctaaacttgctactactcttgtatatttg
aaagattaccaagctgcagttgaaacagctagaaaagcctctaatgttagagtttggtgt
caggttaatagtgcctgtattgataataaggaatttagactagctcaaatttgtggtttg
aatttgatagttcatgcagaagaacttgaagagctggttgcaaaatacgaaagtaatggt
tattttgacgaactgatttcattatttgaagctggtttaggattagaaagggctcacatg
ggtatgtttacagaattagcaatcttgtacaccaagtacgatccacccaagacgtatgaa
catttgaagttattctggtccagaatcaatatcccaaaggtcatcagggcaactgaacgg
gcacacttgtggcaggaattgatatttttatacgcccactatgatgaatgggatagtgct
gctttaacggttattgaaaagtctgccgataacttcgaccatgattatttcaaggaaatc
atagttaaggtttcaaacttggaaatttactatagagctatcaacttttacgtcaaagag
catcctactttgttaattgatttgttggctctactaactccaagattggatatccctaga
gccatgaagatatttaccaaatcggataacttgcctatgatcaaaccctttttgatcagt
gttctgccaaagaataacagtgtcgtgaaccaagcatatcatgatttaatgattgaagag
gaagattacaaagctttgcagaatgctgttcaatcatatgataagtttgaccaattagga
ttggctgctagattagagaaacatgacctaatctttttcaaaaagattgctgcacaattg
taccatagaaataaaaaatggtcaaagagtttagcaattttaactgaaaataaattatgg
aaggacgccattgataccgctgcaatctctcaaaatagacaggttgctgaagatctctta
aactactttgtcgaaactggaaacaacgaagggtttgttgccctgttatattcggcttac
aatttgattagatatgactttgttctggaattggcttggttgaatggcttagagacgttg
attaaaccatatgaaatctcagttaaaaaagagcaattttacaatatccaaaatttatca
aaagccgtctctaaattgtccggaaaggaagctgataatgctgaacagttgttaattacc
aacgggtccgttgatttccagccagcaggattttaa

DBGET integrated database retrieval system