KEGG   Eremothecium cymbalariae: Ecym_1244Help
Entry
Ecym_1244         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
erc  Eremothecium cymbalariae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ecym_1244
Enzymes [BR:erc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ecym_1244
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C44
   Ecym_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(501719..503440)
Genome map
AA seq 573 aa AA seqDB search
MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ
PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF
AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV
YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS
SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL
QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG
IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR
VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE
QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA
ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatttttgcttgttacagacgtgatgggattgagtcatttaagccagtagct
ttacaactttcaaaaagaattagacatcgtggaccagattggtcgggaaatgttgtgaag
aacgacactatatttgtccatgaacggttagcaattgttggattggacactggtgctcaa
cctattgtttcggacgatgggaattatgttttatgtgtcaatggagaaatatataatcac
atccatttgagagatatatgtgctgattatccattttctacgttatctgactgtgaacct
ataattcctttgtttaagaaatatggtgttgagactccaaactatttggatggcatgttt
gcttggtgtttgtacgacgccaaggatgataggattgtggctgccagagaccccattgga
gttactactttatacatgggcaaatgttctaaatcaccaagaacaaggtattttgcatct
gagttgaaatgtcttgtcgaagagtgtgatgagattatatctttcccacctggtcatgtg
tatgactcagacacagaccagatcactagatattttaagcctagttggctggttgacagt
atcactccaactaaaccagtggattacaagaagcttcgtggaggtttggagaaggccgtt
agaaagcggttaatgacggaagttccttacggtgttttgctttctggaggattggattca
tctttaatcgctgctatcgctgcacgtgagacggaaaaggctaacaaagagatggatgtg
gtcaaatacgatagtcaagttagaaacttagtaggtgttgacgatgaactccacctacat
gcctcaggttggtccaagcttcattcgtttgcgattggactaccaaatgctccagatttg
caagcggccagaaaggttgcgaagtttattggttctatccatcacgagcacacatttact
atccaagagggtcttgacgctttggatgatgttattcaccatttggaaactttcgatgtg
acaaccattcgtgcttccactccaatgtttttattatcacgtaagatcaaggcacaaggt
atcaaaatggtcctatccggtgagggttctgatgagattttcggcgggtatttgtacttt
gctcaagcaccgtctgctaaggactttcataatgaatcggttgagagagttaaaaacttg
cacttggctgactgtctccgtgctaacaagtcaactatggcttgggggcttgaagctcgt
gttcccttcttggaccgtgatttcttggagctctgtatgaacatcgaccctgaagagaaa
atgattaaaccaaaagagggtaaaattgagaaatatatcctcaggaaggcctttgacaca
tccgatgaaccagatgttgaaccttacctacctcaggaaatcttgtggagacaaaaggaa
cagttttctgatggtgtaggctattcttggattgacgctttaaaagatgccgctgaaaac
gcaatctcagatgaacaatttgcccaaccaaaaccagaatggggcgacgatattccatcc
acaaaggaagcttactggtaccgtatgaagtttgatgcccttttccctcagcctaccgct
gccagcaccgtaatgagatgggttcccaaggctgaatggggctgctctgaagacccttct
ggaagatttgctaaaattcatgaaaagcacatatctaaatga

DBGET integrated database retrieval system