KEGG   Eremothecium cymbalariae: Ecym_1262Help
Entry
Ecym_1262         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
erc  Eremothecium cymbalariae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:erc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(537544..539121)
Genome map
AA seq 525 aa AA seqDB search
MTIILKKLPEKAKVLVVGGGISGLSFTYFLARLRPDINITLLEASHRCHGYINSSLSVDK
QNHKVLMEKGPRTLRGASEGTSLIIDTLMDLNQKSKVYCLDPSNEANRKFLLDSNNKLIQ
TPNSLSTLLKFLLSTLGKGLIPGILGEPFRKKATTTSTSDETAFSLFSRRFGNKYVAENL
LGALYHGIYADDIKKLSARHVSKKFYEMERDHGSFVRAMFSNKLGKSQLTPVLELYQKTF
AKDPEQFLKLYQNLGKYPILGLKEGLETLPKTLLHASKAFPNVTIHTNKKVTQLGQLSNG
KFEVHTEGGERFNDLDHLRLTVNPSTISNIVTQPKLSNALRLLQSNTIMLVNFYLPNKDV
IKQHHGFGYLVPVSNKNPEMLLGVIFDSIVEQNYQPFFASKEPTISKGPYTKLTAMLGGH
YLTDNKVESLPSTEEIINTVKRVFFTQLNISKSDLNQAHWEVSIVSDSIPKFHVGYEKWM
QAVSKDVSQFYNNNISLGGMAFSSGPGVPDVFTNAFLDAQKVAQA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatattaaaaaagcttcctgagaaggccaaggtgttagtagttggcggtggg
attagtgggctatcgttcacatattttttagccagattgagaccggatatcaatatcaca
ctattagaggcatcgcatagatgtcatgggtacatcaactcttctttaagtgttgataag
cagaatcacaaagttttaatggaaaagggccctaggacacttaggggggcttctgagggc
acttcattgattattgataccttgatggatttaaaccagaagagtaaggtatactgtctt
gatccgagtaatgaggcaaataggaaatttcttttggacagtaataacaaattgattcaa
actcctaattcactatcaacacttttgaagtttcttctcagtactttgggcaagggttta
atacctggtattttgggtgaaccattccgaaaaaaggctactactactagtacatctgat
gaaactgcattcagcttattttccagacgatttggtaacaaatatgtcgcagaaaactta
ttgggggcgttatatcatggaatatatgctgatgatattaaaaagctaagtgcacgtcat
gtttctaagaagttttacgaaatggagagagatcatggttcgttcgtaagggccatgttt
agtaataaattaggaaagagccaattgacccctgtgttggaattataccaaaaaactttt
gcaaaggacccagagcagttcttaaagctttatcagaacctggggaaatatcccatcttg
ggattaaaggaagggctagaaacacttcccaagactttgctacatgcatccaaagctttc
ccaaatgtcacaatccacactaataaaaaggtaacccagttgggtcaattatcaaacgga
aagtttgaagtacacaccgagggtggagagcggtttaatgacctcgatcatctcagacta
actgtaaatccaagcacaatcagtaatatagttactcaacctaaattatccaatgctttg
aggctgttgcaatctaacactatcatgctagtgaacttctaccttccaaataaagatgtc
attaaacagcaccacggatttggttatctagttcctgtttcgaataaaaacccagagatg
ttactaggcgtcattttcgattctattgtagaacaaaactaccagccattttttgcgtcc
aaagagccaactatcagcaagggcccctacacgaagttgaccgctatgttaggtggccat
tatttgaccgacaataaggtagagagtttgccatctacagaagaaatcatcaacactgtc
aaacgtgtattttttacacaattaaatatcagcaagtctgacttgaaccaagctcactgg
gaagtatcaattgtctcggattctatcccaaaattccacgtcggttatgaaaaatggatg
caggcggtttcgaaagacgtatcgcagttttataataacaatatatccctaggtggcatg
gcatttagttctggcccgggtgttccggatgttttcaccaatgcattcctagatgctcag
aaagttgcacaagcgtag

DBGET integrated database retrieval system