KEGG   Eremothecium cymbalariae: Ecym_1262Help
Entry
Ecym_1262         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00860  Porphyrin and chlorophyll metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ecym_1262
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Ecym_1262
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Ecym_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Pyr_redox_2 Thi4 Mqo AlaDh_PNT_C NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 11469651
NCBI-ProteinID: XP_003644321
UniProt: G8JN40
Position
1:complement(537544..539121)
Genome map
AA seq 525 aa AA seqDB search
MTIILKKLPEKAKVLVVGGGISGLSFTYFLARLRPDINITLLEASHRCHGYINSSLSVDK
QNHKVLMEKGPRTLRGASEGTSLIIDTLMDLNQKSKVYCLDPSNEANRKFLLDSNNKLIQ
TPNSLSTLLKFLLSTLGKGLIPGILGEPFRKKATTTSTSDETAFSLFSRRFGNKYVAENL
LGALYHGIYADDIKKLSARHVSKKFYEMERDHGSFVRAMFSNKLGKSQLTPVLELYQKTF
AKDPEQFLKLYQNLGKYPILGLKEGLETLPKTLLHASKAFPNVTIHTNKKVTQLGQLSNG
KFEVHTEGGERFNDLDHLRLTVNPSTISNIVTQPKLSNALRLLQSNTIMLVNFYLPNKDV
IKQHHGFGYLVPVSNKNPEMLLGVIFDSIVEQNYQPFFASKEPTISKGPYTKLTAMLGGH
YLTDNKVESLPSTEEIINTVKRVFFTQLNISKSDLNQAHWEVSIVSDSIPKFHVGYEKWM
QAVSKDVSQFYNNNISLGGMAFSSGPGVPDVFTNAFLDAQKVAQA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatattaaaaaagcttcctgagaaggccaaggtgttagtagttggcggtggg
attagtgggctatcgttcacatattttttagccagattgagaccggatatcaatatcaca
ctattagaggcatcgcatagatgtcatgggtacatcaactcttctttaagtgttgataag
cagaatcacaaagttttaatggaaaagggccctaggacacttaggggggcttctgagggc
acttcattgattattgataccttgatggatttaaaccagaagagtaaggtatactgtctt
gatccgagtaatgaggcaaataggaaatttcttttggacagtaataacaaattgattcaa
actcctaattcactatcaacacttttgaagtttcttctcagtactttgggcaagggttta
atacctggtattttgggtgaaccattccgaaaaaaggctactactactagtacatctgat
gaaactgcattcagcttattttccagacgatttggtaacaaatatgtcgcagaaaactta
ttgggggcgttatatcatggaatatatgctgatgatattaaaaagctaagtgcacgtcat
gtttctaagaagttttacgaaatggagagagatcatggttcgttcgtaagggccatgttt
agtaataaattaggaaagagccaattgacccctgtgttggaattataccaaaaaactttt
gcaaaggacccagagcagttcttaaagctttatcagaacctggggaaatatcccatcttg
ggattaaaggaagggctagaaacacttcccaagactttgctacatgcatccaaagctttc
ccaaatgtcacaatccacactaataaaaaggtaacccagttgggtcaattatcaaacgga
aagtttgaagtacacaccgagggtggagagcggtttaatgacctcgatcatctcagacta
actgtaaatccaagcacaatcagtaatatagttactcaacctaaattatccaatgctttg
aggctgttgcaatctaacactatcatgctagtgaacttctaccttccaaataaagatgtc
attaaacagcaccacggatttggttatctagttcctgtttcgaataaaaacccagagatg
ttactaggcgtcattttcgattctattgtagaacaaaactaccagccattttttgcgtcc
aaagagccaactatcagcaagggcccctacacgaagttgaccgctatgttaggtggccat
tatttgaccgacaataaggtagagagtttgccatctacagaagaaatcatcaacactgtc
aaacgtgtattttttacacaattaaatatcagcaagtctgacttgaaccaagctcactgg
gaagtatcaattgtctcggattctatcccaaaattccacgtcggttatgaaaaatggatg
caggcggtttcgaaagacgtatcgcagttttataataacaatatatccctaggtggcatg
gcatttagttctggcccgggtgttccggatgttttcaccaatgcattcctagatgctcag
aaagttgcacaagcgtag

DBGET integrated database retrieval system